KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0660Help
Entry
PEPE_0660         CDS       T00409                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ppe00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
699062..700585
Genome map
AA seq 507 aa AA seqDB search
MDLEIATVKAILTEHDLLKEIKSTKTVANTGISYDSRTVKPGYMFFCKGNFKPEYLSVAR
QNGATTYVSENEYPEGTGMTAIIVTNVTRAMAVLSATYYNFPQNDLFIIGITGTKGKTSS
AYFAHSILNQKYPNQVALFSTIDRIVGPKPEDQFKSDLTTPESMNLFHDMRVAVDNGMKY
LVMEVSSQAYLRDRVYGLKFDCGIFLNITPDHIGRNEHKDFEDYLHCKLQLMVNSKRCII
DADTDRFDDVFGAAKATTDPEQIYLFSADVENGGVDFLIQDEEDDLTSNRFTLVESSSKA
EAFHVAGDYDLNVAGDYNQSNATAAIIAAALADVTYQDAVLPLKSIVIPGRMEHLNVPGH
GVVFVDYAHNYASLHALLKFLKHQYHDGKVIVVVGSPGDKGISRRAGFGQALSEQADIAY
LTTDDPAFEDPEQIIQQIMDNIKPGTVEVRQVLDRHDAIEQAIMNSSEKDVVVLAGKGED
PYQKVGGVDTPWPTDMGVAEEVKRGLS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaccttgaaattgccactgttaaggcaatccttacagaacatgatttattaaaagaa
atcaaatcaactaaaacagttgcaaatactggaatatcttatgattctagaaccgtaaag
ccaggttatatgttcttttgcaaaggaaatttcaaaccagagtatttatcagtagcccgc
caaaatggtgctaccacttatgtgtctgagaatgaatatccagaaggaaccggcatgact
gcgattattgtaacgaatgttacaagagccatggcggttctttcggctacttattacaat
tttccgcaaaatgacttgtttattatcgggattacgggaacgaagggtaagaccagttca
gcttactttgcacactcaattttgaatcaaaagtatccaaaccaagtggctctattttca
acaattgatcgaattgtgggacccaagcctgaggaccaatttaaatcagatttaaccaca
ccagaatcaatgaatttattccatgatatgcgagtcgctgtggataatgggatgaaatat
ctggtaatggaagtgtcttcgcaagcttatttaagagaccgggtttatggattaaaattt
gattgtggaatctttttaaacattacgccggatcacattgggcgcaatgagcacaaagat
tttgaagattacttgcattgcaaattacaattaatggttaactctaaacgttgtattatt
gatgcagatacagatcgttttgatgatgtttttggcgctgcaaaagcaacaactgatccg
gaacaaatttatttgtttagtgcagatgttgaaaatggtggagtagatttcttaattcaa
gatgaagaagatgatcttacttccaatcgattcactttggttgaaagcagttcaaaagca
gaagcattccacgtggcaggtgattacgatttaaatgtggcgggcgattacaatcaaagt
aatgcaacggctgccattattgctgctgcccttgcagacgttacttatcaggatgcagtg
ttaccactaaaatcaatcgtgattccaggtcgtatggaacatctaaatgttccaggacat
ggagtggtttttgtagattatgcacacaattatgctagtttgcacgcactattaaaattc
ttaaagcatcaatatcacgatggtaaggttatcgtggtggttggaagtcctggtgataaa
gggatttcgagaagagctgggttcggtcaagcgttgagtgaacaagcagatattgcttat
ttgacaacggatgatccagcttttgaagatccagaacaaattatccagcaaattatggat
aatattaaacctggtacagttgaagttcgtcaggtacttgaccgacacgatgcaatcgag
caagcgattatgaatagtagtgagaaagatgtggtcgtgcttgccggaaaaggtgaagat
ccataccaaaaagttggaggggtagatactccttggccaactgatatgggagtagcagaa
gaagtgaagaggggattaagttaa

DBGET integrated database retrieval system