KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0732Help
Entry
PEPE_0732         CDS       T00409                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PEPE_0732
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PEPE_0732
   00052 Galactose metabolism
    PEPE_0732
   00500 Starch and sucrose metabolism
    PEPE_0732
   00520 Amino sugar and nucleotide sugar metabolism
    PEPE_0732
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PEPE_0732
   00524 Butirosin and neomycin biosynthesis
    PEPE_0732
Enzymes [BR:ppe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PEPE_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
770647..771609
Genome map
AA seq 320 aa AA seqDB search
MERKLIGVDLGGTTIKFAILTENGDVQQKWSVETNVLDEGSHIVPDIIDSINHHLDLYKM
TKDQFIGIGMGTPGTVNRENGTVIGAFNLNWKETQYVKDAIEDGTGIKFAIDNDANVAGL
GERWKGAGENGEDVSFVTLGTGIGGGLIAGGQLLHGLAGAAGEIGHVTVDPEGYLCTCGK
RGCLEQYASATGVVHVARDMAEEFSGDSELKRETDDGQDITSKLVFDLAKKGDVLALRVV
DRVCSLLGLALGNLANTLNPESIVIGGGVSAAGDFLLERVRNYYEQYAFSTVRSSTQLKL
ARLGNDAGVIGAASLARVFA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaaattaatcggtgtcgatcttggtggaacaacaattaagtttgctatttta
actgaaaatggcgatgttcaacaaaaatggagtgtggaaacaaatgttttagatgaaggt
tcacacattgttccagacattattgactcaatcaatcatcatcttgatttatataagatg
actaaggatcaatttattggaatcgggatgggaacaccgggaactgtaaaccgcgaaaat
ggtacagtaattggtgctttcaacctgaactggaaagaaactcaatacgttaaggatgca
attgaagatggtacaggaatcaagtttgccattgataacgatgctaatgttgctggtcta
ggtgaacgttggaagggtgctggagaaaacggcgaagatgtttctttcgttactcttggt
accggtatcggtggcggtttgattgctggtggacaattgcttcatggtttagctggagct
gctggtgaaatcggacatgttacggttgatcctgaaggttacctatgtacatgtggtaag
cgtggatgtcttgaacaatatgccagtgctacaggtgttgttcatgtagcccgcgacatg
gcagaagaattttctggcgattcagaacttaaacgtgaaactgatgacggacaagatatt
acttctaaattagttttcgaccttgcaaagaagggtgacgttttagctcttcgtgttgtt
gatcgggtctgcagtctcttaggacttgctttaggtaacttggctaatactttaaaccct
gaaagcattgttatcggtggcggagtttcagcagctggtgatttcttattagaacgtgtc
cgtaattattacgaacaatatgcattctcaactgttcgttcttcaacccaattaaaatta
gctcgcttaggaaatgacgctggtgtaatcggtgccgcttcattagctcgtgtatttgca
taa

DBGET integrated database retrieval system