KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1093Help
Entry
PEPE_1093         CDS       T00409                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
ppe00010  Glycolysis / Gluconeogenesis
ppe00030  Pentose phosphate pathway
ppe00051  Fructose and mannose metabolism
ppe00052  Galactose metabolism
ppe00680  Methane metabolism
ppe01100  Metabolic pathways
ppe01110  Biosynthesis of secondary metabolites
ppe01120  Microbial metabolism in diverse environments
ppe01130  Biosynthesis of antibiotics
ppe01200  Carbon metabolism
ppe01230  Biosynthesis of amino acids
ppe03018  RNA degradation
Module
ppe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PEPE_1093
   00030 Pentose phosphate pathway
    PEPE_1093
   00051 Fructose and mannose metabolism
    PEPE_1093
   00052 Galactose metabolism
    PEPE_1093
  Energy metabolism
   00680 Methane metabolism
    PEPE_1093
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PEPE_1093
Enzymes [BR:ppe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PEPE_1093
Protein phosphatases and associated proteins [BR:ppe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PEPE_1093
Messenger RNA biogenesis [BR:ppe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PEPE_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase ExbD Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ABJ68148
JGI: PEPE1093
UniProt: Q03F74
Position
complement(1088378..1089346)
Genome map
AA seq 322 aa AA seqDB search
MKRIGIMTSGGDAPGMNLAIRAVARKALSSGLEAYGINYGFAGLVAGDIHEFKAADLDDM
VSQGGTMLYSARYPEFAQEESQLKGIEQLKKFGIDALVVIGGDGSYHGALRLTEHGYNTI
GLPGTIDNDIPFTDFTIGFDTALNTAVDAIDKIRDTAKSHQRVFAVQVMGRNAADIALWA
GVASGADAVIAPGFDYDVEAIANKLKKNRANGKDYGIIVIAEGDANSDAAPEFIDQLKQY
GDFDARATVIGHVQRGGVPSAKDRVLASKMGAYAVELLLEGKGGLAVGILENKVQAHNML
DLFDAKHQADDSLYQLSEDLSF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtatcatgacaagtggtggggatgctccagggatgaacttggctatc
cgcgccgttgcaagaaaggccctaagctctggtcttgaagcttacggaattaactacggg
tttgccggtctagttgctggtgatatccacgaattcaaggcagcagatttagacgatatg
gtttcacaaggtggaacgatgctttattcagctcgttatcctgaatttgcacaagaagaa
agccaattgaaaggtattgaacaacttaagaagttcggtatcgatgcattggttgttatc
ggaggagacggttcatatcatggtgctcttcgtttgacagaacatggatacaacaccatt
ggtcttccaggaacaatcgataatgatattcctttcactgacttcactattggttttgat
acagcgttaaacactgcagttgacgcgattgataaaattcgcgatactgctaagagtcat
caacgggtctttgctgtccaagttatgggccgcaatgctgctgatattgctctttgggct
ggtgttgcttcaggagcagatgcggttatcgcacctggttttgattatgacgttgaagca
attgccaacaagttgaaaaagaaccgtgcaaacggtaaggactacggcattattgtcatc
gctgaaggtgatgctaattcagatgcagctcctgaattcattgaccagcttaagcaatac
ggcgattttgatgcacgtgctactgtaattggacatgtccaacgtggtggtgttccaagt
gctaaagatcgcgttttagcaagtaagatgggtgcttacgctgttgagctactccttgaa
ggtaagggtggtttagcagttggaatcttagaaaataaggttcaagctcataacatgctt
gacttgtttgatgcaaaacatcaagcagatgattcactttaccaattaagtgaagattta
tcattctag

DBGET integrated database retrieval system