KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1093Help
Entry
PEPE_1093         CDS       T00409                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PEPE_1093
   01230 Biosynthesis of amino acids
    PEPE_1093
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PEPE_1093
   00030 Pentose phosphate pathway
    PEPE_1093
   00051 Fructose and mannose metabolism
    PEPE_1093
   00052 Galactose metabolism
    PEPE_1093
  Energy metabolism
   00680 Methane metabolism
    PEPE_1093
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PEPE_1093
Enzymes [BR:ppe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PEPE_1093
Protein phosphatases and associated proteins [BR:ppe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PEPE_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1088378..1089346)
Genome map
AA seq 322 aa AA seqDB search
MKRIGIMTSGGDAPGMNLAIRAVARKALSSGLEAYGINYGFAGLVAGDIHEFKAADLDDM
VSQGGTMLYSARYPEFAQEESQLKGIEQLKKFGIDALVVIGGDGSYHGALRLTEHGYNTI
GLPGTIDNDIPFTDFTIGFDTALNTAVDAIDKIRDTAKSHQRVFAVQVMGRNAADIALWA
GVASGADAVIAPGFDYDVEAIANKLKKNRANGKDYGIIVIAEGDANSDAAPEFIDQLKQY
GDFDARATVIGHVQRGGVPSAKDRVLASKMGAYAVELLLEGKGGLAVGILENKVQAHNML
DLFDAKHQADDSLYQLSEDLSF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtatcatgacaagtggtggggatgctccagggatgaacttggctatc
cgcgccgttgcaagaaaggccctaagctctggtcttgaagcttacggaattaactacggg
tttgccggtctagttgctggtgatatccacgaattcaaggcagcagatttagacgatatg
gtttcacaaggtggaacgatgctttattcagctcgttatcctgaatttgcacaagaagaa
agccaattgaaaggtattgaacaacttaagaagttcggtatcgatgcattggttgttatc
ggaggagacggttcatatcatggtgctcttcgtttgacagaacatggatacaacaccatt
ggtcttccaggaacaatcgataatgatattcctttcactgacttcactattggttttgat
acagcgttaaacactgcagttgacgcgattgataaaattcgcgatactgctaagagtcat
caacgggtctttgctgtccaagttatgggccgcaatgctgctgatattgctctttgggct
ggtgttgcttcaggagcagatgcggttatcgcacctggttttgattatgacgttgaagca
attgccaacaagttgaaaaagaaccgtgcaaacggtaaggactacggcattattgtcatc
gctgaaggtgatgctaattcagatgcagctcctgaattcattgaccagcttaagcaatac
ggcgattttgatgcacgtgctactgtaattggacatgtccaacgtggtggtgttccaagt
gctaaagatcgcgttttagcaagtaagatgggtgcttacgctgttgagctactccttgaa
ggtaagggtggtttagcagttggaatcttagaaaataaggttcaagctcataacatgctt
gacttgtttgatgcaaaacatcaagcagatgattcactttaccaattaagtgaagattta
tcattctag

DBGET integrated database retrieval system