KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1169Help
Entry
PEPE_1169         CDS       T00409                                 

Definition
ATP-dependent RecD/TraA family DNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PEPE_1169
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PEPE_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1168805..1171249)
Genome map
AA seq 814 aa AA seqDB search
MAFEKMNLFGDADPKKQSQNKMVELIGEISAVFFESPDSLFKVLLVTVEEDDFDWSEEQI
VVTGNIGDVQEGQKYQFNGKLIAHPKYGMQIQANQYRAFMPNTEDGVVTYLSGSQFKGIG
TKTAEKIVEALGSDALNEIKKDPGVLNGLNLKEKQIDMIVSVLDQSNGLEDILIKLSDMG
ITGKIASSIVNKYHEDAINIIEENPYRLVEDIENIGFKRADAIAASLNIKPDFEKRIQAG
ILEAIKTWCNATGDTYILADMLLQEARKLLGTAVNAEAIADQVLQLGKDGKVVGEDGQIY
LKWLYNAEVAISYNVKRMVGESNSNVKGIKRAIKAAEKNLNLKYDDTQNAAIELALSHPL
TIITGGPGTGKTTIVKGLINSFAELNDISLDINEYTESKFPIQLAAPTGRAAKRLSQVTN
VPAKTIHRLLGLNGNDDLQNDEIKQLEGDLLVIDEMSMVDTGLFSTLVNAINPDMQVVLV
GDKDQLPSVGPGQIFNDLIKSGKIPTISLTKIYRQEQDSSIIQLAHDIQKGVLPEDFTKN
KKDKSFFLANANQIVDAIDQIAQKAVDKGISKNDIQVLAPMYRGSAGVDEINRHLQKVLN
PPQTDKPKKIESGNQTFRIGDKVLQLVNSPENNIFNGDIGEITGIVMEKQGKGRAHLVVD
YDGNEVTYAKTDLGQLTLAYCISIHKSQGSEFPVVIMPMVHQYYRMLQRNLLYTGLTRAS
NSIILLGEPDAYQRAVSNESSNRNTSLERRINPQVEVLAEKVNQIQVSEPVDQEQSTSEP
VEVEQPKYLTTSMVQKEQVDPMIGMEGVTPYDFI
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgagaaaatgaatttatttggcgatgctgacccaaaaaagcagtctcaaaat
aagatggtcgaactgattggtgaaattagtgcggtcttttttgagagcccagatagttta
tttaaagtgctcctggttactgtagaagaagatgattttgactggtccgaagagcagatt
gtcgttactggaaatattggtgacgtacaagaaggacagaagtatcaatttaatggaaaa
ctaattgcacatcctaagtatggtatgcaaattcaagctaatcaatatcgagcgtttatg
ccaaatacagaagatggtgttgttacatatttgtcgggatcacaattcaaaggaattgga
acgaaaaccgctgaaaaaattgttgaagctttgggatcggatgcacttaatgaaattaag
aaagaccctggagttttaaacggtctaaaccttaaagaaaagcaaattgatatgattgta
tcggttttggaccagtccaatggattagaggatatccttataaagctcagtgatatgggg
attacaggaaaaattgctagtagtatcgtaaataaataccatgaggatgcaattaacatc
attgaagagaatccctaccgattggtcgaggatatcgaaaatattggttttaaacgagct
gatgctatcgctgctagcttaaatattaaaccggattttgaaaaacgaattcaagcagga
attttagaagcaattaaaacttggtgtaatgccacaggtgatacttatattttggcagat
atgctactccaagaagcccgaaagcttttaggtacggctgtaaatgctgaagctattgca
gatcaagttttacagctaggtaaagatggaaaagtcgtaggtgaggacggccaaatttat
ctgaaatggttatataatgctgaggtcgctattagttataacgttaaacgcatggtcggt
gaatcgaattcgaacgttaaaggtattaagcgggcaatcaaagccgctgaaaagaatcta
aatttaaagtatgatgatacgcagaatgcagcgattgaacttgcactttcacatcctctg
acaattattactggtggcccagggacagggaagactacaattgttaaggggttaattaat
agctttgcagaattaaatgatatttcgttggatattaacgaatatacggaaagtaaattc
cccattcagttagcagccccaactggtcgagcagctaaaagattaagccaagttacgaat
gtaccagctaaaactattcatcgtttgctagggttaaatggtaatgacgatctccagaat
gatgaaataaagcagcttgaaggcgatttgttagttatcgacgagatgtctatggttgat
actggattatttagtacgttggttaatgccattaatccagatatgcaagtggtattggta
ggagataaagaccaattaccatcagttggaccaggacaaatatttaatgatttaattaaa
agtggtaaaattccaaccatttcgttaacaaaaatttatcgtcaagaacaagattcatcg
attattcagttagcccacgatatccaaaaaggggtattacctgaagattttaccaaaaat
aaaaaagataaatccttctttctagccaacgctaatcaaattgttgacgcaatagatcaa
atcgcgcaaaaagctgtagataaagggatttctaagaatgatattcaagttttagcaccg
atgtatcgaggtagtgcaggagtagatgaaattaaccgacatctacaaaaagttttaaat
ccacctcaaacggataaaccgaagaaaatcgaatctggcaatcaaacttttagaattggt
gataaagttttgcaattggttaattcacctgaaaataatatctttaatggtgatattggc
gaaattaccggaatcgttatggaaaagcaaggcaaaggcagagctcatctagtcgttgac
tatgatggaaatgaggttacgtatgctaaaactgaccttggacaattgaccttggcatat
tgtatttcgattcataaatcacaaggtagtgaatttccggtggtgattatgcctatggtg
catcaatactatcgaatgttacaacgcaacctcttatatacagggctaactcgtgcgtcc
aattcgattattttgttgggtgaacctgatgcttaccaaagagcggtaagcaatgaatca
tctaatcgaaataccagtttagaacgtcgaattaatccgcaagtagaagttttagctgaa
aaagtaaaccaaatacaagtatcagaaccagttgatcaagagcaatcaacgtcagagcca
gtggaagtagagcaaccaaagtatttaactacgtcgatggttcaaaaagaacaggtagac
ccaatgattggaatggaaggggtcacaccgtatgattttatttag

DBGET integrated database retrieval system