KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1272Help
Entry
PEPE_1272         CDS       T00409                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PEPE_1272
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PEPE_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1259371..1259958)
Genome map
AA seq 195 aa AA seqDB search
MYEYLDGVVVNVNPAYIVVDVNGVGFLVNVANPYSFELDAKQKVFVHQAVSENDQTLYGF
KKAEDKELFLNLLKVKGIGPKSALAILANDDHTGLINAINNDDVSYLKKFPKIGPKAAQQ
IILDLKGKVAVENEVGTLFDLSTTSNQALDEALEALIALGYSEKEVKKLTKKLSEQTDRT
TDQYISSGLKLLMKG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatatttagatggagtcgtcgttaacgttaatccagcttatattgttgttgat
gtcaatggagttggatttttagttaacgtggctaatccatatagttttgaactagatgct
aaacagaaagtttttgttcatcaagctgtttcagaaaatgatcaaactttatatggattt
aaaaaagctgaagataaagaactttttcttaatttattaaaagttaaggggattggtccg
aaaagtgcgttggctattttagcgaacgatgatcatacagggttgattaatgcgattaat
aatgatgatgtaagttatctcaaaaagttccctaagattggtcctaaggctgctcaacaa
atcattctagatttgaagggcaaagtggcggttgaaaatgaagtaggaaccctttttgat
ttatcaactacttcaaaccaagctctagatgaagctctagaagctttgattgcattaggt
tattctgaaaaagaggttaagaaattaactaagaaattgagtgaacaaactgatcggaca
actgatcagtatattagttcgggattaaaattattgatgaaaggataa

DBGET integrated database retrieval system