KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1510Help
Entry
PEPE_1510         CDS       T00409                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PEPE_1510
   01230 Biosynthesis of amino acids
    PEPE_1510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PEPE_1510
  Energy metabolism
   00680 Methane metabolism
    PEPE_1510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PEPE_1510
Enzymes [BR:ppe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PEPE_1510
Exosome [BR:ppe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PEPE_1510
  Exosomal proteins of melanoma cells
   PEPE_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1477164..1477844)
Genome map
AA seq 226 aa AA seqDB search
MAKLVLIRHGESTANRDNIYTGWSDVPLTPLGIKQAQRAGKLIAKLGINFDMVHTSMLKR
AIVTANIVLDDLNQNWLPINKTWRLNERHYGALRGQNKDETRQIYGKEQVALWRRSFDAV
PPLLEHPDDDRRYAVNGILNEPLGESLHMAYNRLLPYWIDQIAPRLMEGQNQLVVAHGSS
LRALIKYLENISDQGIDGVEVENGEPIIYELKSDLSIQNKIILKEA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaattagttttaattaggcatggggaaagtaccgccaatcgtgataatatttat
acagggtggtcggatgttccgcttactccgcttggtattaagcaagcacaacgagcagga
aaattaattgctaaattaggaattaattttgatatggttcacacttcaatgctgaagcgc
gcgattgtgactgctaatatcgttttagatgatcttaatcaaaattggttaccgattaat
aagacttggcgattaaatgaacgccattatggggctttaaggggacaaaataaggatgag
acccgccaaatttatggtaaggagcaggttgctttatggcgtcggagttttgatgcagta
ccacccctgctagagcatcccgatgatgatcgacgatatgcggttaatggaattttgaat
gaaccactgggtgaaagtttacatatggcttataatcgcttgctaccatactggattgat
caaattgctcctagattaatggaaggacaaaatcaattggtagtcgcacatggaagttct
ttgcgagcattaattaaatatttggagaacatttctgaccagggtattgatggagtcgaa
gttgaaaatggagaacccatcatttacgaattaaaatcggatttatctatccaaaataaa
attatcttgaaagaagcctaa

DBGET integrated database retrieval system