KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1623Help
Entry
PEPE_1623         CDS       T00409                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppe00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1602712..1604226
Genome map
AA seq 504 aa AA seqDB search
MADKYILAIDEGTTSTRTIIFDHAGNKMADAQREFPQYFPKPGWVEHNANEIWNAVLSTI
ANAFIESGIKPNQISGIGITNQRETTVIWDKKTGLPIYNAVVWQSRQTAEIAEQLVKDGY
GDMIHQKTGLVTDAYFSATKIRWILDHVDGAQARAERGELLFGTIDTWLMWKLTDGDVHV
TDYSNASRTMLYNIHKLEWDKEILALLNIPASMLPEVKPNSTIYGKTKDYHFYGSEVPIS
GMAGDQQAALFGQLAFEPGMVKNTYGTGAFTVMNTGEKPQLSDNNLLTTIGYGINGKVYY
ALEGSIFVAGSAIQWLRDGMKLFKKASESEAAAVASQNDNEVYVVPAFTGLGAPYWDPNA
RGSVFGITRGTTREDFIKATLQSLAYQSRDVIDTMKKDSGIDIPSIRVDGGASNNDYLMQ
FQSDILGIEIDRASDLETTALGAAFLAGLAVGFWKDLEDLKKEYKPGKVFKPKMSTDERE
DLYTGWQEAVAATRQFKHRPRQSK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaatatattcttgccatcgacgaagggacgactagtactcgtacaatcatc
tttgatcatgctggaaataaaatggcagatgctcaaagagaatttccacagtactttccg
aaacctggatgggtagaacataatgccaacgaaatatggaatgccgtattgtcgaccatt
gctaatgcatttatcgagtcaggaattaagcccaaccaaattagtggaattggtattacc
aatcaacgagaaactaccgtgatttgggataaaaagaccgggcttcccatttataacgct
gtagtgtggcaatctcgacagacagcagaaattgctgaacaactcgtaaaagatgggtat
ggcgacatgattcaccaaaaaacgggactagttacagacgcttacttctcggcaaccaaa
attcgctggattcttgaccacgttgatggcgcacaagcacgcgccgaacgcggcgagctg
ttgtttggaaccattgatacatggctaatgtggaaattaacggatggtgatgtgcacgtc
actgactattccaacgctagccgcaccatgttatataacattcacaaattagaatgggac
aaagaaattctcgctttacttaatatccccgcttcaatgcttccggaagttaaacctaac
tctaccatttacggtaaaaccaaagattaccacttttatggtagcgaagttcccatctct
ggaatggctggcgatcagcaagcggccttatttggtcaattagctttcgaacccggaatg
gtcaaaaatacctacgggactggtgcatttaccgtaatgaacacaggtgaaaaaccgcaa
ttatctgataataatttattaaccaccattggttacggtattaatggcaaagtctattac
gcactagaaggtagtatttttgtggctggttcggcaattcaatggcttcgtgatggaatg
aaactgtttaaaaaggcttctgaatcagaggcagccgctgttgcttctcaaaatgataat
gaagtctatgttgtaccagcttttaccggactgggtgctccgtactgggatcctaatgct
cgaggttcagtttttggaatcactcgtggaactacccgtgaagatttcattaaagctacc
cttcaatcccttgcataccaatctcgtgacgttattgacactatgaaaaaggattcagga
attgatattccttccattcgtgtcgatggtggcgcttctaataatgattacttgatgcaa
ttccaatctgatattttaggaattgaaattgatcgtgctagtgatctcgaaaccaccgct
ctaggcgccgcatttcttgcgggattagcagttggattctggaaagaccttgaagattta
aagaaagaatataagccagggaaggtattcaaaccaaagatgtcaactgatgagcgtgaa
gacttatacacaggttggcaagaagcggttgcagcaactcgtcaatttaaacatcgacca
cgacaatcaaaataa

DBGET integrated database retrieval system