KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1699Help
Entry
PEPE_1699         CDS       T00409                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PEPE_1699
Enzymes [BR:ppe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PEPE_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1673744..1674652)
Genome map
AA seq 302 aa AA seqDB search
MNTVTIIGSINLDRTIRVKQMPKPGETMHTKEIFSAGGGKGANQAVAAKRSEAKTNFIGA
VGNDDAGRAMLELLEHENIDMSGIETLDNQSTGQAYIVVDDAGENQIMIHAGANTAFTPE
YVQSKADLIKNSDFIIAQFESSLDSVTEAFKIAREAGVKTILNPAPAVEKVPSDLLAVTD
MIIPNETETEILTGIEVTDEASMKKASKALHDEGIEAVLITIGSKGTFYDVNGKSGIIPA
FKVKAVDTTSAGDTFIGAMSTVLNKDFSNLEDAILYGNKASSLTVQRFGAQPSIPYKKEL
EK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgtaacaattattgggagcattaacttagaccgtactatccgagtaaaacaa
atgccaaaaccaggtgaaaccatgcatacgaaagaaattttttcagctggtggcggaaag
ggagctaaccaagctgtagctgctaagcgttctgaagctaagacaaactttattggtgca
gttggtaatgacgatgctggccgtgcaatgttagaattattggaacatgaaaatattgat
atgagcggaattgaaactttagataaccaatctacaggacaagcatacatagtagtagat
gacgctggtgaaaatcaaatcatgattcatgcgggtgctaatactgcatttactccagaa
tatgtccagtctaaagctgatttaatcaaaaatagtgatttcattattgctcaatttgaa
agttctttagattcagttacggaagcctttaagattgctcgtgaagcaggcgttaaaaca
atcttgaatcccgctccagcggttgaaaaggttcctagtgatttattagcagtaacggat
atgatcattcctaatgaaactgaaactgaaattttaaccggaatcgaagtaacagatgaa
gcaagtatgaagaaagcttctaaagcattacatgatgaaggaattgaagcagttttgatt
accattggtagcaaaggaaccttctacgatgttaatggtaaaagtggaattatccccgca
tttaaggtaaaggctgttgatacaacttctgctggagatacattcattggagcaatgagc
accgttttgaataaagactttagtaacttagaagatgccatcttatatggtaataaagct
tcatccctaactgtacaacgctttggtgcacaaccatcaatcccttacaaaaaagaattg
gaaaaatag

DBGET integrated database retrieval system