KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1705Help
Entry
PEPE_1705         CDS       T00409                                 

Definition
fructose-2,6-bisphosphatase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PEPE_1705
   01230 Biosynthesis of amino acids
    PEPE_1705
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PEPE_1705
  Energy metabolism
   00680 Methane metabolism
    PEPE_1705
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PEPE_1705
Enzymes [BR:ppe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     PEPE_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1683216..1683824
Genome map
AA seq 202 aa AA seqDB search
MDLTIVRHSISSDNGRGLISGAGSDVDLSEAGIELAQEAQRAFDWNQFDQVFSSPMRRAK
QTAELLLGDQASAINFDERLTEMNFGDWDGTAEDAIFEQYPEIFNQMGMFNEKYSDYAPN
SESYDELVNRVTGFLDELKQKYPTASILLICHGMTTRALFAALLHVSPAQFGKIGNVTLN
QIHLDETNHFEPRIDLYNQKLN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggatttaacaattgtacgacatagtattagtagcgataacggtcgcggattaatttcg
ggggctggttctgatgttgatctttcagaagctggaatcgagttagcccaagaggctcaa
cgtgcttttgactggaatcaatttgatcaagttttctctagtcccatgcgtcgggctaaa
caaacggccgaattactcttaggtgaccaagcttcagcgattaattttgatgaacgttta
actgaaatgaattttggagactgggatggaactgccgaagacgcaatttttgaacaatat
cctgaaattttcaatcaaatgggaatgtttaatgagaagtattccgattatgcacccaat
tcagaaagttacgatgagctggttaaccgcgtaacaggctttttagatgaattgaagcaa
aaatatccgactgcatcaatcctactcatttgtcacggaatgactacgcgagccctcttt
gctgccttactccacgtcagtcctgcccaatttggtaagattggcaacgttactctaaat
caaattcatctagatgaaactaatcattttgaaccccgcattgatctttacaatcaaaaa
ttaaattaa

DBGET integrated database retrieval system