KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1705Help
Entry
PEPE_1705         CDS       T00409                                 

Definition
(GenBank) Fructose-2,6-bisphosphatase
Organism
ppe  Pediococcus pentosaceus ATCC 25745
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1683216..1683824
Genome map
AA seq 202 aa AA seqDB search
MDLTIVRHSISSDNGRGLISGAGSDVDLSEAGIELAQEAQRAFDWNQFDQVFSSPMRRAK
QTAELLLGDQASAINFDERLTEMNFGDWDGTAEDAIFEQYPEIFNQMGMFNEKYSDYAPN
SESYDELVNRVTGFLDELKQKYPTASILLICHGMTTRALFAALLHVSPAQFGKIGNVTLN
QIHLDETNHFEPRIDLYNQKLN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggatttaacaattgtacgacatagtattagtagcgataacggtcgcggattaatttcg
ggggctggttctgatgttgatctttcagaagctggaatcgagttagcccaagaggctcaa
cgtgcttttgactggaatcaatttgatcaagttttctctagtcccatgcgtcgggctaaa
caaacggccgaattactcttaggtgaccaagcttcagcgattaattttgatgaacgttta
actgaaatgaattttggagactgggatggaactgccgaagacgcaatttttgaacaatat
cctgaaattttcaatcaaatgggaatgtttaatgagaagtattccgattatgcacccaat
tcagaaagttacgatgagctggttaaccgcgtaacaggctttttagatgaattgaagcaa
aaatatccgactgcatcaatcctactcatttgtcacggaatgactacgcgagccctcttt
gctgccttactccacgtcagtcctgcccaatttggtaagattggcaacgttactctaaat
caaattcatctagatgaaactaatcattttgaaccccgcattgatctttacaatcaaaaa
ttaaattaa

DBGET integrated database retrieval system