KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_1705Help
Entry
PEPE_1705         CDS       T00409                                 

Definition
(GenBank) Fructose-2,6-bisphosphatase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PEPE_1705
   01230 Biosynthesis of amino acids
    PEPE_1705
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PEPE_1705
  Energy metabolism
   00680 Methane metabolism
    PEPE_1705
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PEPE_1705
Enzymes [BR:ppe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     PEPE_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1683216..1683824
Genome map
AA seq 202 aa AA seqDB search
MDLTIVRHSISSDNGRGLISGAGSDVDLSEAGIELAQEAQRAFDWNQFDQVFSSPMRRAK
QTAELLLGDQASAINFDERLTEMNFGDWDGTAEDAIFEQYPEIFNQMGMFNEKYSDYAPN
SESYDELVNRVTGFLDELKQKYPTASILLICHGMTTRALFAALLHVSPAQFGKIGNVTLN
QIHLDETNHFEPRIDLYNQKLN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggatttaacaattgtacgacatagtattagtagcgataacggtcgcggattaatttcg
ggggctggttctgatgttgatctttcagaagctggaatcgagttagcccaagaggctcaa
cgtgcttttgactggaatcaatttgatcaagttttctctagtcccatgcgtcgggctaaa
caaacggccgaattactcttaggtgaccaagcttcagcgattaattttgatgaacgttta
actgaaatgaattttggagactgggatggaactgccgaagacgcaatttttgaacaatat
cctgaaattttcaatcaaatgggaatgtttaatgagaagtattccgattatgcacccaat
tcagaaagttacgatgagctggttaaccgcgtaacaggctttttagatgaattgaagcaa
aaatatccgactgcatcaatcctactcatttgtcacggaatgactacgcgagccctcttt
gctgccttactccacgtcagtcctgcccaatttggtaagattggcaacgttactctaaat
caaattcatctagatgaaactaatcattttgaaccccgcattgatctttacaatcaaaaa
ttaaattaa

DBGET integrated database retrieval system