KEGG   Prunus persica (peach): 18776102Help
Entry
18776102          CDS       T03092                                 

Definition
(RefSeq) acid beta-fructofuranosidase 2, vacuolar
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pper  Prunus persica (peach)
Pathway
pper00052  Galactose metabolism
pper00500  Starch and sucrose metabolism
pper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    18776102
   00500 Starch and sucrose metabolism
    18776102
Enzymes [BR:pper01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     18776102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 18776102
NCBI-ProteinID: XP_007210314
UniProt: M5WQD6
Position
G5
AA seq 686 aa AA seqDB search
MADPRPFLPSDLNTLPCTYTPLPNGANPDGGAPETRKRHLKELLAIFSGLLMVSLLVVII
SGKEPNSHNASNKHEPLFLAKQPHTARPEKLRPVSRGVPAGVSEKMNRLAGDVDGPVFPW
NNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNKAVWGDIVWGHAVSKDL
IHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPADHSDP
LLLNWVKYSGNPVLVPPPGIGYKDFRDPTTAWFTSEGKWRITIGSKLNKTGISLVYDTKD
FKTYELLNGVLHAVPGTGMWECVDFYPVSKTSDKGLDTSANGPDVKHVVKASLDDDRNDY
YAFGTYDEKTGKWVPDNQKIDVGIGIRYDYGKFYASKTFYDQNKGRRVLWGWIGESDSES
ADVQKGWASLQGIPRTVLFDQKTGSNLLQWPVEEIEKLRLSSKDFNKVEVKAGSVEPLQV
GTATQLDIVAEFELDKKVLESVAESNEAFSCNTSGGAAKRGALGPFGLLVLADESLSEQT
PVYFYVAKGPGGIVDTFFCADQTRSSVANDVRKEITGSYIPVLKDEKLSVRILVDHSIVE
SFAQGGRTTITNRIYPTKAIYGAARLFVFNNATEISVTASIKVWQLNSAFIRPYHQDESS
LASFNHVTFIKLIAPFFIFLTLFFVR
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccaagaccttttcttccatcagatctcaataccctgccctgcacctacacc
cctctgccaaatggagccaacccggatggaggagccccggagacccggaagaggcacttg
aaggagctcctagcaatcttttctgggttgcttatggtttctctcttggtggtcattata
agtggcaaggaaccaaattcccataatgcaagcaacaaacatgaacccttgtttttggct
aaacagcctcatacagcacgccccgagaaattgaggccagtttctaggggcgtgccggcc
ggagtgtccgagaagatgaaccggttagccggggacgtggacgggccggtgtttccatgg
aacaatagcatgttgtcatggcagagaactgccttccattttcagcctgaaaagaattgg
atgaatgatcccaacggtccattattttacaagggctggtaccatttcttctaccagtac
aatcccaacaaagcagtatggggagacatagtttggggacatgctgtgtccaaggacttg
atccactggcttcaccttcctctggccatggtggctgatcagtggtatgacatcaatggc
gtttggactggctcagccaccattctccctgatggtaaaattgtcatgctctacactggt
tcaaccaatgagtctgtccaggtccaaaaccttgcatatcctgctgaccactctgaccct
ctcctcctcaactgggtcaagtactccggcaacccggtcctagtcccgcccccgggcatc
gggtacaaggacttccgggaccctacgacggcatggttcacgtcagagggcaaatggcgg
atcaccattgggtccaagcttaacaaaactgggatatctttggtttatgacaccaaggac
ttcaaaacctatgagcttctgaatggggtgcttcatgctgtccctgggactggaatgtgg
gagtgtgtggatttttatccggtgtcgaaaaccagtgacaagggattggatacttctgcg
aacgggcctgatgtgaagcatgtggtaaaggctagccttgatgatgacaggaatgattac
tatgcgttcgggacttatgatgagaagactggcaaatgggttcccgataaccaaaagatt
gatgttggtattggaattaggtatgattatggcaaattctatgcctccaagactttctat
gaccaaaacaaggggaggagagtgttgtggggttggattggagagtctgatagtgaaagt
gctgatgtacaaaagggatgggcctctcttcagggaattcctagaacagttttgtttgac
cagaagactggaagcaacctacttcaatggccggtggaggagattgagaagttgagattg
agcagcaaggatttcaacaaggtagaggtgaaggcagggtcggtggagccacttcaagtt
ggcacagccacacagttggacattgttgccgagtttgaattggacaagaaggttttagag
agcgtagctgaatccaatgaggccttcagttgcaataccagcggtggggctgccaaacgc
ggcgctttgggacccttcggtcttcttgttcttgcagatgagagcctctcagagcagact
cctgtctacttctatgttgccaaaggacctggtggcattgtcgacactttcttctgtgct
gatcaaacaaggtcttccgtggcaaatgacgttcgtaaagaaattactggtagctatatt
ccggttctaaaggatgagaaattatcagtgaggatactggttgaccattcgattgtggaa
agctttgctcaaggtggaagaacaacgatcacaaatcggatttacccaaccaaggcaatt
tatggggctgctaggctatttgtgttcaacaatgccacagagatcagtgttacagcatcc
atcaaagtatggcagttgaactctgctttcatacgcccataccaccaggacgaaagcagc
ctcgcaagcttcaaccatgttacatttatcaaattaattgcaccgttcttcattttttta
actttattttttgttagatag

DBGET integrated database retrieval system