KEGG   Prunus persica (peach): PRUPE_ppa006160mgHelp
Entry
PRUPE_ppa006160mg CDS       T03092                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pper  Prunus persica (peach)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PRUPE_ppa006160mg
Enzymes [BR:pper01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PRUPE_ppa006160mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 425 aa AA seqDB search
MNFLLSFCFCLCVSRLPSFATPAVLFQGFNWDSSKKGGWYNSLKTTIPELASSGITHVWL
PPPSHSNGTEGYDPGRLYDLDASSYGNKDELKSLIATMHEKGIKAIADIVLNHRSAVKQD
ENGIWSIFEGGTEDGRLDFNASLICRDDNDHPFGTGNPDTGDNFPYTADVDHTNPRLQTE
LSDWLNWLKTDIGFDGWRLDYVIGYGSSFTKLYMEKTSPEFAVAEYWRWNISKGQDGKLD
KNQDAHRNEIVNWIEAAGGVVTAFDLTTKYILNVAVEGELWRLKDSNGKPPGLIGIKPES
AVTFIDNHDTWSQGLLPFPDDKVLLGYAYILTHPGTPSIFYDHFFDWGWPKESIRNLTAI
RARNGINSRSSVTILAAEADLYMANIDDKIIMKIGPRLGLGDLDPTKSNFHVATSGQDFA
VWEKN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcctttcattctgcttttgcctctgcgtttctcgtttgccctcattcgca
actccagctgtgttatttcaggggttcaattgggattcaagtaaaaaaggaggatggtac
aactccctcaagaccaccattcccgaactcgctagctctggaattacccatgtctggctt
cctcctccttctcactctaatggaactgagggatacgacccgggaaggctatacgatctc
gatgcatcaagctatggaaataaggacgaattgaagtccctgattgctactatgcatgag
aagggaatcaaagccatcgctgacattgtgttaaaccacagatcagctgtcaaacaagac
gagaatggaatatggagcatctttgaaggtggaacagaagacggacgtcttgacttcaat
gcctcattgatctgcagagatgacaatgaccatccttttggaactggaaatccagacaca
ggggacaactttccttacactgctgatgtggaccacaccaatccaaggctacaaaccgag
ctctctgattggttgaattggttgaaaactgatatagggtttgatggatggaggttggat
tatgtgattggatatggctccagcttcaccaagctctacatggaaaagacttcaccagaa
tttgcagttgctgagtattggcgttggaacatttcaaaagggcaggatggcaaacttgac
aagaaccaagatgcacataggaatgaaatagtgaattggatcgaggctgctggtggcgtt
gtcacggcgttcgatttgacaaccaagtacatcttgaatgttgctgtggagggtgagcta
tggaggctcaaggattctaatggaaaaccaccaggtttgattgggatcaaaccagaaagt
gctgtaacatttattgacaatcatgacacttggtctcagggacttttgcctttcccagat
gacaaagtcctgcttggatatgcttacattctcacccatcctgggaccccaagcatattc
tatgatcacttctttgactgggggtggccaaaggagtctatacgcaatttgactgcaatt
agggcaaggaatggaataaattccaggagcagtgtgactattttagctgcagaggctgat
ctatatatggccaacattgatgacaagattatcatgaagattgggccaagattgggcctt
ggagaccttgatcccacaaagtcaaacttccatgttgccaccagtggacaagacttcgct
gtttgggagaaaaattga

DBGET integrated database retrieval system