KEGG   Prunus persica (peach): PRUPE_ppa006843mgHelp
Entry
PRUPE_ppa006843mg CDS       T03092                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pper  Prunus persica (peach)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PRUPE_ppa006843mg
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PRUPE_ppa006843mg
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PRUPE_ppa006843mg
Lipid biosynthesis proteins [BR:pper01004]
 Desaturase
  First
   PRUPE_ppa006843mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 393 aa AA seqDB search
MDLITSPPSNPKTHHCFPLHRTFNRPGRPVLGFRPLPQSSKVLNFVHYDSKQSQPNKFLT
STKLFSHLLTNSNRTVPTISTNAALSEATEPEAETEPGKYRRILLSDVIVKRPRNVFMGR
EWNLRDMATAGVVLAMHLLSLFAPFQFNWGAFWVAVALYVVTGLFGITLSYHRNLSHKSF
KLPKWLEYLFAYCAVQALQGSPIDWVSTHRYHHQFCDSERDPHSPIEGFWCSHISWLFDT
NSVAERCGGSNNAGDLEKQPFYQLIQKTYIAHPIALGVLLYAMGGFPFLVWGMGVRIIWV
YHITWLVNSACHVWGKQAWNTCDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLNWWQL
DMTWYVVKFLQAIGLATDVKLPTEAHKQRMALN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggatttgatcacatcaccaccgtccaatcccaaaacccaccattgtttccctcttcac
cgcacgtttaaccggccaggaagacccgttttagggttcaggccattgcctcagagttcc
aaggtcctaaattttgttcattatgattcaaaacaatcacaacccaataagtttttaaca
agcacaaagcttttcagccatttgcttaccaattccaatagaacagtaccaacaataagt
accaatgcagctttgtccgaagccacagaaccagaggcagagacagagccagggaagtat
aggagaattctattgtctgatgtgattgtgaagaggcctaggaatgtgtttatggggaga
gaatggaacttaagggatatggccacagctggtgttgttttggcaatgcatttgctcagt
ctttttgcaccttttcaattcaattggggagctttttgggtggcagtggcactttatgtt
gtgactggtctatttggcatcactctttcttatcataggaatctttcacacaagagtttc
aagctccccaagtggcttgaatacttgtttgcttattgtgcagttcaagcacttcagggg
agcccaattgattgggtgagcacacataggtaccaccaccagttttgtgattcagagaga
gacccacatagcccaattgaaggtttctggtgtagtcacattagttggctctttgatacc
aattctgtggctgaaaggtgtgggggatcaaataatgctggggatttagagaagcagccc
ttctatcagctcattcagaaaacttacattgctcaccccattgctcttggagttctactg
tatgcaatgggaggattcccattccttgtgtggggaatgggtgtgagaattatatgggta
taccacattacatggctggttaactcggcttgccacgtgtggggaaagcaagcatggaat
acttgtgacttgtccaggaacaattggtgggtggcattattagcatttggagagggttgg
cacaataatcaccacgcttttgagtactcagctagacatggcctcaattggtggcaactt
gacatgacttggtatgttgtgaaatttctccaagctattggattggcaactgacgtgaag
ttacccacagaggcccacaaacaaagaatggctttgaactaa

DBGET integrated database retrieval system