KEGG   Prunus persica (peach): PRUPE_ppa008069mgHelp
Entry
PRUPE_ppa008069mg CDS       T03092                                 

Definition
hypothetical protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
pper  Prunus persica (peach)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    PRUPE_ppa008069mg
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     PRUPE_ppa008069mg
    1.1.1.234  flavanone 4-reductase
     PRUPE_ppa008069mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 346 aa AA seqDB search
MGPESESVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLELPKAETHLTL
WKADLADEGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDILKACLKAKTV
RRLVFTSSAGTVNVEEHQKSYYDETDWSDVEFCRSVKMTGWMYFASKTLAEQAAWKFAKE
NNIDFITIIPTLVIGPFLMPSMPPSLITGLSPLTGNTSHYSIIKRGQFVHLDDLCLSHIY
LYEHPKAEGRYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTNIHFSSKKLTDH
GFEFKYSLEDMFVGAVDTCRARGLIPIPAEKHEADDNTVVDVKVSG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggggccagagtctgaatctgtttgtgtgacgggcgcttccggtttcatcggctcatgg
ctcgtcatgagactcttagagcgcggttacactgttcgagccaccgtgcgggatcctacg
aatcagaagaaggtgaagcatctgctggagttgccaaaggccgagacgcacttgacgctg
tggaaggctgacctggcggacgagggaagctttgatgaagccattcaaggctgcaccgga
gtgttccatgtcgccactcctatggattttgagtccaaagaccccgagaacgaagtgatc
aagccaacaataaatggggtgctagacatcctcaaggcatgcctcaaggcaaaaacagtt
cgaaggctggtgtttacatcctcagcaggaaccgtgaatgtcgaagagcaccagaagtca
tactatgacgaaaccgactggagcgatgttgaattttgccgctctgtcaaaatgactggt
tggatgtacttcgcctccaagactctagctgagcaagctgcatggaagtttgccaaagaa
aacaacattgatttcattaccattatcccaactcttgtgattggcccatttctcatgcca
tccatgccaccaagcctcatcaccggactttccccactcactggaaatacatctcattat
tcgattataaagcgagggcagttcgttcacttggacgacctctgcctctctcacatatac
ttgtacgagcaccctaaagctgagggccgctacatttgttcttcccatgatgctacaatt
tacgacattgcaaaattgctgagagaaaaataccccgagtacaatattcccacaaagttc
gataacattgaggagaacttgaccaatatccatttttcttcaaagaagttgacggaccac
gggtttgagttcaaatacagcttggaggacatgttcgtaggggctgttgatacctgcaga
gcaaggggtttgatcccaattcctgctgagaaacatgaggctgacgacaacaccgtcgtc
gatgtcaaagtctccggttaa

DBGET integrated database retrieval system