KEGG   Prunus persica (peach): PRUPE_ppa020081mgHelp
Entry
PRUPE_ppa020081mg CDS       T03092                                 

Definition
(RefSeq) hypothetical protein
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pper  Prunus persica (peach)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PRUPE_ppa020081mg
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PRUPE_ppa020081mg
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PRUPE_ppa020081mg
Lipid biosynthesis proteins [BR:pper01004]
 Desaturase
  First
   PRUPE_ppa020081mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 229 aa AA seqDB search
MGLLGKVLRKSCGEFWGRKWNIQDVFTVAVFLALYSLCAFAPFHFNWPAFWVAITLYVAT
GLGIRLCYHRSLLHTEFQASKMARGSPIERVSTHRYHHQFTDTGKDPHSPIKVLWYSHMG
WILNSRHCFEQPFYRFLGRTKFLHPIALGGLLYVVGGFPFLVWGMVGGIVCAWRRLANNH
HAFEYSARHGLEWWQIDFTWYIIRFLQAIGAATNVKVPTEIQKQRKSFK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggggcttctgggcaaagttcttaggaagtcttgtggagagttttgggggaggaaatgg
aacatacaagatgtattcacagtggctgtgtttttggctttgtattccctttgtgcattt
gctccctttcatttcaattggcctgcattttgggtggccatcactttgtacgttgcaacg
gggttaggaatcaggttgtgttaccatagaagtcttttgcacacagaatttcaggcttcc
aaaatggctcgaggcagtccgattgaacgtgtgagtacgcatcggtaccaccatcagttt
actgacacgggaaaagaccctcacagccccatcaaggttttatggtatagtcacatgggt
tggatccttaatagccgtcattgttttgaacagcccttctataggtttcttggtcgtact
aagtttctacatccaattgctcttggaggtttgctatatgttgtgggtggatttcccttc
ttggtctggggcatggtgggtggcattgtttgcgcttggagaaggttggcaaataaccac
cacgcttttgaatactcggctcgacatgggctagaatggtggcaaattgattttacttgg
tacataataagatttcttcaagctattggagcggcaacaaatgtgaaggtcccaactgaa
attcaaaagcaacgaaaaagcttcaaataa

DBGET integrated database retrieval system