KEGG   Prunus persica (peach): PRUPE_ppa024349mgHelp
Entry
PRUPE_ppa024349mg CDS       T03092                                 

Definition
hypothetical protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
pper  Prunus persica (peach)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    PRUPE_ppa024349mg
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PRUPE_ppa024349mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 259 aa AA seqDB search
MASDQNFFHNCLLSLYLIAPPTYISLRFLQAPYGKHRRPGWGPTMSPPLAWFLMESPTLW
LTLLLFPSGLHSSNPKALFLIVPFLFHYFHRTFLYPLRLCRNTTNPKTSGGFPVSVALMA
FGFNLLNAYLQARWVSQYKDYEADGWFWWRFCVGLVVFGYGMAVNIWSDRVLVGLKKEGK
GYKVPKGGWFELVSCPNYYGEIVEWLGWAVMTWSWAGLGFFLYTCANLVPRARANHKWYL
EKFGEDYPRGRKAVIPFLY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagatcagaacttcttccacaactgcctcctcagcctctacctcatagcaccg
ccaacctacatctccctcaggttcctccaggccccctatggcaagcaccgccgcccaggt
tggggccccaccatgtcccctcccttggcctggttcctcatggaaagcccaactctttgg
ctcaccctcctcctcttcccctccggcctccactcttccaacccaaaagccctttttctc
atcgtaccctttctcttccactacttccaccgcaccttcctctacccgctccgcctctgc
cggaataccaccaatcccaaaacatcaggcggttttccggtgagcgtggcgctcatggca
tttgggttcaatctgttgaatgcctacttgcaggccagatgggtttctcagtacaaagat
tatgaggctgatgggtggttttggtggagattctgtgttgggttggtggtgtttggttat
ggcatggctgtgaatatctggtctgatagggtcttggtgggattgaagaaagaggggaag
gggtacaaggtgccaaaagggggttggtttgagttggtgagctgcccaaactactatggg
gagatagtggagtggttgggatgggcagtgatgacgtggtcctgggctgggctagggttt
ttcctctacacgtgtgccaacttggtgcccagggcacgtgcgaaccataagtggtatttg
gagaaatttggggaggattatcccaggggcagaaaagctgtcatccccttcttgtattga

DBGET integrated database retrieval system