KEGG   Pseudomonas putida F1: Pput_0097Help
Entry
Pput_0097         CDS       T00537                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00260  Glycine, serine and threonine metabolism
ppf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01130  Biosynthesis of antibiotics
ppf01230  Biosynthesis of amino acids
Module
ppf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pput_0097
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pput_0097
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pput_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase PA BtpA
Motif
Other DBs
NCBI-ProteinID: ABQ76272
JGI: Pput0097
UniProt: A5VWL2
Position
complement(103166..103975)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVDTFVAEAKA
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAKSADQAVTDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
accttcgtcacagctggcgacccgggctacgacgcctcgctgcagatcctcaagggcctg
ccggctgctggcgccgacgtgatcgagctgggcatgccgttcaccgacccgatggccgat
ggcgtggccattcagttggccaccctgcgcgcccttgaagctggccagaccttggccaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacgccgatcgtgctgatg
ggctactacaaccctatccaccgctttggcgtggacacgttcgtggctgaagccaaggca
gcgggcgtcgatggcctgatcatcgtcgaccttccgccagagcacgacgccgaactggct
accccggcccaggctgcaggcatcgacttcatccgcctgaccactccgaccaccgacgac
gcgcgcctgccgcgcgtgctggagcgcagctccgggttcgtctactacgtgtcggtggct
ggtgtaaccggtgcaggttcggcgaccaccgagcatgtgaccgaagccattgcccgcctg
cgccggcataccgatctgccgatcagcgttggcttcggcattcgcacgccggaacaggct
gcgaacattgcccgcttggcggatggtgtggtggtgggctcggcactggtcgacaagatc
gcccaggccaaaagcgccgatcaggcggtgaccgatgtattgagcctgtgctcggcactg
gctgaaggggtgcgtggcgcacgccgctaa

DBGET integrated database retrieval system