KEGG   Pseudomonas putida F1: Pput_0098Help
Entry
Pput_0098         CDS       T00537                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pput_0098
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pput_0098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pput_0098
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pput_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(103972..105189)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLVACVG
GGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNGGVPGVLHGNRTYLLQDQDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESS
HALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMAAQEKHA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaatggcctgttcggctcgttcggc
ggccgctacgtggccgaaaccctgatgccactggtgctggacctggcccgcgaatacgaa
gcggccaaggcagaccccaagttccttgaagagctggcttattttcagcgcgactacatc
ggccgccccaacccgctgtacttcgccgagcgcctgaccgagcattgcggcggagcgaag
attttcttcaagcgtgaagagctcaaccataccggcgcgcacaaggtgaacaactgcatc
ggccaggtgctgctggccaagcgcatgggcaaaaagcgcctgatcgccgaaaccggcgcc
ggcatgcacggtgtcgccaccgccactgtcgccgcgcgcttcggcctgccttgcgtgatc
tacatgggcgccaccgacatcgagcgccagcaggcgaacgtattccgcatgaagctgctg
ggcgccgagatcgtgccggttaccgccggcaccggcaccctgaaagacgccatgaacgaa
gccctgcgtgactgggttaccaacgtcgaagacaccttctacctgatcggcaccgtggct
ggcccacacccgtaccccgccatggtccgcgatttccagtcgatcatcggcaaagagacc
cgtgcccagttgcaagagaaggaaggccgtctgccagacagcctggttgcctgcgtcggc
ggcggctccaatgccatgggcctgttccatgagttcctcgaagagccgagcgtgcagatc
atcggcgttgaagccggtggccacggcgtacacaccgacaagcatgccgccagcctgaac
ggcggcgtaccgggcgtattgcacggcaaccgcacctacctgctgcaggaccaagacggc
cagatcaccgatgcccactcgatttccgcaggcctggactacccgggcatcggcccggag
cacgcctatctgcatgaggtgaagcgcgtcgagtacgtcagcatcaccgatgacgaagca
ttggatgcgttccacgcaacctgccgtctggaaggcatcattccagccctggaaagctcc
cacgccttggccgaagcgatcaagcgcgcaccgaagctgcccaaggaccacctgatggtc
gtgtgcctgtcgggccgcggcgacaaagacatgcaaaccgtcatgaaccacatggccgcc
caggagaaacacgcatga

DBGET integrated database retrieval system