KEGG   Pseudomonas putida F1: Pput_0098Help
Entry
Pput_0098         CDS       T00537                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00260  Glycine, serine and threonine metabolism
ppf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01130  Biosynthesis of antibiotics
ppf01230  Biosynthesis of amino acids
Module
ppf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pput_0098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pput_0098
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pput_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ76273
JGI: Pput0098
UniProt: A5VWL3
Position
complement(103972..105189)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLVACVG
GGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNGGVPGVLHGNRTYLLQDQDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESS
HALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMAAQEKHA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaatggcctgttcggctcgttcggc
ggccgctacgtggccgaaaccctgatgccactggtgctggacctggcccgcgaatacgaa
gcggccaaggcagaccccaagttccttgaagagctggcttattttcagcgcgactacatc
ggccgccccaacccgctgtacttcgccgagcgcctgaccgagcattgcggcggagcgaag
attttcttcaagcgtgaagagctcaaccataccggcgcgcacaaggtgaacaactgcatc
ggccaggtgctgctggccaagcgcatgggcaaaaagcgcctgatcgccgaaaccggcgcc
ggcatgcacggtgtcgccaccgccactgtcgccgcgcgcttcggcctgccttgcgtgatc
tacatgggcgccaccgacatcgagcgccagcaggcgaacgtattccgcatgaagctgctg
ggcgccgagatcgtgccggttaccgccggcaccggcaccctgaaagacgccatgaacgaa
gccctgcgtgactgggttaccaacgtcgaagacaccttctacctgatcggcaccgtggct
ggcccacacccgtaccccgccatggtccgcgatttccagtcgatcatcggcaaagagacc
cgtgcccagttgcaagagaaggaaggccgtctgccagacagcctggttgcctgcgtcggc
ggcggctccaatgccatgggcctgttccatgagttcctcgaagagccgagcgtgcagatc
atcggcgttgaagccggtggccacggcgtacacaccgacaagcatgccgccagcctgaac
ggcggcgtaccgggcgtattgcacggcaaccgcacctacctgctgcaggaccaagacggc
cagatcaccgatgcccactcgatttccgcaggcctggactacccgggcatcggcccggag
cacgcctatctgcatgaggtgaagcgcgtcgagtacgtcagcatcaccgatgacgaagca
ttggatgcgttccacgcaacctgccgtctggaaggcatcattccagccctggaaagctcc
cacgccttggccgaagcgatcaagcgcgcaccgaagctgcccaaggaccacctgatggtc
gtgtgcctgtcgggccgcggcgacaaagacatgcaaaccgtcatgaaccacatggccgcc
caggagaaacacgcatga

DBGET integrated database retrieval system