KEGG   Pseudomonas putida F1: Pput_0146Help
Entry
Pput_0146         CDS       T00537                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppf  Pseudomonas putida F1
Brite
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Pput_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
147729..149666
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEETRPGFLQRLFGSREEDAQA
GAELEPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPAPAAPTAEVAEAPELELEAFGPA
LIETAEMAPAPLPRDKAPLPEAAVSVSEPLAEAEPLQVLEETFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSVQGAAD
VDSLKHILENRLEGLLLTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSEQVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTTPAVAAQMAEVLRATVEACPFHFKG
ERVVITTSIGLGAFRSGERSDQVLKRADAALYRAKEQGRNRVEHG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgaacgccgttgggatgcccgtcttgacctgctgcgtcgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgccggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgaaccaagtcagcgatgcgctg
accgcactggttggccaactgcaaggcctgcccctgcccagtgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctg
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagccgggtgaa
gaaacccgacccgggtttctgcagcggttgttcggaagccgcgaggaagatgcacaggca
ggagcagagcttgagccggtggcgttgcctgctgccgaggttgtgccccaggcagccggc
agtgccgagccctcgcggcccgatgacgtcgatgcgctacaaccgttgccggcccctgct
gctccgactgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccggcg
ctgatcgaaacggccgaaatggcgccagccccgttgccaagggacaaggcgccattgccg
gaagctgcagtttccgtcagcgagccgttggctgaggcagaacccttacaagtccttgaa
gaaacctttggtgaagacggcccctatgctctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgaccttagcctgccc
gagcgccacaaggctcaggcgttggaaatgcgcgagcgggttgcgcgcggcttgaactgg
tatgagctgatcccggtgctggatgacttggcagtcctcatgctggcgatcaccgacagc
ggccagcacgaattcgaaacctacctgcagcagctcaatgaacgcctggaaggtttccaa
agccacctgcacgaggccagcgccggtcacgcggacaacagcaccgctgcccgcgagctg
gatagccaactgcgtgagcacgtcgacggcctgcagagcagcgtgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttgctgctgaccatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctatcgcgagcacctggaagaa
cagcgccagaaagcgctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcaagtcgaacgcgaaatgcttgactggcaggaaaacggcggtcatctggcgatggcg
attcttgacctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgcctgcggggccgggatttcatc
gcccgttttggcggcgaggaattcgtcttgctgttgccgcagactacgcccgcagtcgct
gcgcaaatggccgaggtgttgcgcgccacagtcgaagcctgcccattccacttcaagggt
gaacgggtagtgatcaccacctccatcggcctgggtgcattccgttctggcgaacgcagc
gaccaggtgctcaaacgagccgatgcagcgctgtaccgggcaaaggagcaggggcgtaat
cgcgtcgagcatggttag

DBGET integrated database retrieval system