KEGG   Pseudomonas putida F1: Pput_0146Help
Entry
Pput_0146         CDS       T00537                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ppf  Pseudomonas putida F1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
147729..149666
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEETRPGFLQRLFGSREEDAQA
GAELEPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPAPAAPTAEVAEAPELELEAFGPA
LIETAEMAPAPLPRDKAPLPEAAVSVSEPLAEAEPLQVLEETFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSVQGAAD
VDSLKHILENRLEGLLLTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSEQVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTTPAVAAQMAEVLRATVEACPFHFKG
ERVVITTSIGLGAFRSGERSDQVLKRADAALYRAKEQGRNRVEHG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgaacgccgttgggatgcccgtcttgacctgctgcgtcgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgccggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgaaccaagtcagcgatgcgctg
accgcactggttggccaactgcaaggcctgcccctgcccagtgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctg
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagccgggtgaa
gaaacccgacccgggtttctgcagcggttgttcggaagccgcgaggaagatgcacaggca
ggagcagagcttgagccggtggcgttgcctgctgccgaggttgtgccccaggcagccggc
agtgccgagccctcgcggcccgatgacgtcgatgcgctacaaccgttgccggcccctgct
gctccgactgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccggcg
ctgatcgaaacggccgaaatggcgccagccccgttgccaagggacaaggcgccattgccg
gaagctgcagtttccgtcagcgagccgttggctgaggcagaacccttacaagtccttgaa
gaaacctttggtgaagacggcccctatgctctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgaccttagcctgccc
gagcgccacaaggctcaggcgttggaaatgcgcgagcgggttgcgcgcggcttgaactgg
tatgagctgatcccggtgctggatgacttggcagtcctcatgctggcgatcaccgacagc
ggccagcacgaattcgaaacctacctgcagcagctcaatgaacgcctggaaggtttccaa
agccacctgcacgaggccagcgccggtcacgcggacaacagcaccgctgcccgcgagctg
gatagccaactgcgtgagcacgtcgacggcctgcagagcagcgtgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttgctgctgaccatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctatcgcgagcacctggaagaa
cagcgccagaaagcgctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcaagtcgaacgcgaaatgcttgactggcaggaaaacggcggtcatctggcgatggcg
attcttgacctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgcctgcggggccgggatttcatc
gcccgttttggcggcgaggaattcgtcttgctgttgccgcagactacgcccgcagtcgct
gcgcaaatggccgaggtgttgcgcgccacagtcgaagcctgcccattccacttcaagggt
gaacgggtagtgatcaccacctccatcggcctgggtgcattccgttctggcgaacgcagc
gaccaggtgctcaaacgagccgatgcagcgctgtaccgggcaaaggagcaggggcgtaat
cgcgtcgagcatggttag

DBGET integrated database retrieval system