KEGG   Pseudomonas putida F1: Pput_0229Help
Entry
Pput_0229         CDS       T00537                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00250  Alanine, aspartate and glutamate metabolism
ppf00310  Lysine degradation
ppf00650  Butanoate metabolism
ppf01100  Metabolic pathways
ppf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Pput_0229
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pput_0229
   00310 Lysine degradation
    Pput_0229
Enzymes [BR:ppf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Pput_0229
    2.6.1.48  5-aminovalerate transaminase
     Pput_0229
Amino acid related enzymes [BR:ppf01007]
 Aminotransferase (transaminase)
  Class III
   Pput_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABQ76403
JGI: Pput0229
UniProt: A5VWZ3
Position
268034..269311
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGIS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVIEVFEEEKLLDRSKAVGERLTAGLREIQKKYPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEEC
FAEIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaccaacgaatccttgatgcaacgtcgtgtagctgccgtcccacgtggcgtc
ggccagatccacccgatcttcgtcgacaccgcgaagaactcgaccgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagtactgaacaccggccacctgcac
ccgaaagtggttgcagccgtgcaagagcagctgaccaaggtcagccacacctgcttccag
gtgctggcttacgagccctacgtagagctgtgcgaaaagatcaacaagctggtcccaggc
gacttcgacaagaagaccctgctggtcaccaccggctccgaagccgttgaaaacgccgtc
aagatcgcccgtgctgccactggccgcgctggcgtcatcgccttcaccggcggttatcac
ggccgtaccatgatgaccctgggcctgaccggcaaggtcgtgccgtactccgctggcatg
ggcctgatgccaggcggcatcttccgcgccctgttcccgagcgaactgcacggtatcagc
gttgacgacgccatcgcctcggtcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgccgcgatcatcctcgagccagtacaaggcgaaggcggcttcctgccagcgccgaaa
gagctgatgaaacgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtacaaactggcgctggccgtaccggcaccttcttcgccatggaacagatgggcgtt
gcgcctgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgaatacatggacgccatcgcgcctggcggcctgggcggtacctacgcg
ggttcgccgatcgcttgcgccgcagccctggccgtgatcgaagtgttcgaagaagaaaaa
ctgctggaccgcagcaaggctgtgggtgagcgcctgaccgccggcctgcgcgaaatccag
aagaagtacccgatcatcggcgacgtccgtggtctgggctcgatgattgccgtcgaagtc
ttcgagaaaggcactcacaccccgaacgcagctgctgttggccaggttgtcgccaaggct
cgtgaaaagggtctgatcctgctgtcttgcggcacctacggcaacgtcctgcgtatcctg
gttccgctgaccgccgaagacgcgctgctggacaaaggcctggccatcatcgaagagtgc
ttcgctgaaatcgcctga

DBGET integrated database retrieval system