KEGG   Pseudomonas putida F1: Pput_0229Help
Entry
Pput_0229         CDS       T00537                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppf  Pseudomonas putida F1
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Pput_0229
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pput_0229
   00310 Lysine degradation
    Pput_0229
Enzymes [BR:ppf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Pput_0229
    2.6.1.48  5-aminovalerate transaminase
     Pput_0229
Amino acid related enzymes [BR:ppf01007]
 Aminotransferase (transaminase)
  Class III
   Pput_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
268034..269311
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGIS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVIEVFEEEKLLDRSKAVGERLTAGLREIQKKYPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEEC
FAEIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaccaacgaatccttgatgcaacgtcgtgtagctgccgtcccacgtggcgtc
ggccagatccacccgatcttcgtcgacaccgcgaagaactcgaccgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagtactgaacaccggccacctgcac
ccgaaagtggttgcagccgtgcaagagcagctgaccaaggtcagccacacctgcttccag
gtgctggcttacgagccctacgtagagctgtgcgaaaagatcaacaagctggtcccaggc
gacttcgacaagaagaccctgctggtcaccaccggctccgaagccgttgaaaacgccgtc
aagatcgcccgtgctgccactggccgcgctggcgtcatcgccttcaccggcggttatcac
ggccgtaccatgatgaccctgggcctgaccggcaaggtcgtgccgtactccgctggcatg
ggcctgatgccaggcggcatcttccgcgccctgttcccgagcgaactgcacggtatcagc
gttgacgacgccatcgcctcggtcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgccgcgatcatcctcgagccagtacaaggcgaaggcggcttcctgccagcgccgaaa
gagctgatgaaacgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtacaaactggcgctggccgtaccggcaccttcttcgccatggaacagatgggcgtt
gcgcctgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgaatacatggacgccatcgcgcctggcggcctgggcggtacctacgcg
ggttcgccgatcgcttgcgccgcagccctggccgtgatcgaagtgttcgaagaagaaaaa
ctgctggaccgcagcaaggctgtgggtgagcgcctgaccgccggcctgcgcgaaatccag
aagaagtacccgatcatcggcgacgtccgtggtctgggctcgatgattgccgtcgaagtc
ttcgagaaaggcactcacaccccgaacgcagctgctgttggccaggttgtcgccaaggct
cgtgaaaagggtctgatcctgctgtcttgcggcacctacggcaacgtcctgcgtatcctg
gttccgctgaccgccgaagacgcgctgctggacaaaggcctggccatcatcgaagagtgc
ttcgctgaaatcgcctga

DBGET integrated database retrieval system