KEGG   Pseudomonas putida F1: Pput_0276Help
Entry
Pput_0276         CDS       T00537                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppf  Pseudomonas putida F1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pput_0276
Enzymes [BR:ppf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Pput_0276
Transfer RNA biogenesis [BR:ppf03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Pput_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
318652..319470
Genome map
AA seq 272 aa AA seqDB search
MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAADLAAHRVIADGLLALAP
QIPVLSEEDCNIALAERQSWSRWWLVDPLDGTKEFIAGSEEFTVNIALIENGEVVFGVVS
MPTNGRCYFGGRGMGAWRADAGEAAQLIQVRNAPAQGERFTVVASRRHSSPEQEALLAGL
GAAVGELELANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVVEGAGGEVIGLDGL
PFRYPPRESLLNPHFLALPANAAWRQAFLNLI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgcaactgatgcacgaagtggtcaagctggcgctgacggcaggcgaggcg
atcctgccattctggcgcgccgatgtcgcggtaaccaacaaggccgacgattcgccggtt
accgccgccgacctggccgcgcaccgggtaattgccgatggtctgctggcgctggcgccg
cagattccggtgctgtccgaagaggactgcaatattgcgctggccgagcggcaaagctgg
agccgctggtggctggtcgatccgctggatggcaccaaggaattcattgccggcagtgaa
gagttcacggtcaacatcgccctgatcgagaacggcgaggtggtgtttggcgtggtgtcg
atgcccaccaatgggcgctgctattttggtgggcgcggcatgggggcctggcgtgcagat
gccggtgaggcagcccagctgatccaagtacgcaacgcacccgcgcagggcgagcgtttt
accgtggtggccagccgtcggcattccagcccggagcaggaagcgctgttggccggcctt
ggggctgcggtgggcgagctggagctggccaatattggcagctcgttgaagttctgcctg
ttggccgagggcagcgccgattgttatccgcgcctggcgccgacttcgcagtgggatact
gctgcggcgcagggtgtggtggagggggccggtggcgaagtgatcgggctggatggcttg
ccgttccggtatccaccgcgcgagtcgctgctcaatccgcatttcctggcattgcctgcc
aatgctgcatggcgccaggccttcctgaacctcatctaa

DBGET integrated database retrieval system