KEGG   Pseudomonas putida F1: Pput_0350Help
Entry
Pput_0350         CDS       T00537                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00625  Chloroalkane and chloroalkene degradation
ppf00680  Methane metabolism
ppf01100  Metabolic pathways
ppf01120  Microbial metabolism in diverse environments
ppf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Pput_0350
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pput_0350
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Pput_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2 PALP
Motif
Other DBs
NCBI-ProteinID: ABQ76523
JGI: Pput0350
UniProt: A5VXB3
Position
400536..401735
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTA
QVGLVLGHEITGEIVEKGRDVERMQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPERDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGDLNPARLAHAKSQGFEVVDLSKD
TPLHEQIVDILGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVAGNIGIP
GLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSFHTGQTPTMKYNRQLMQAIMWDRINIA
EVVGVQVINLDQAPEGYGEFDAGVPKKFVIDPHKMWGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggagtggtatatctcggcgccggcaaggtcgaagtgcaacacatc
gactacccgaaaatgcaggacccgcgcggcaagaaaatcgaacacggcgtcatcctgaag
gtggtctccaccaacatctgcggttctgaccagcacatggtccgtggccgcaccactgcc
caggtcggcctggtcctgggccacgaaatcaccggtgaaatcgtcgagaagggtcgcgat
gtcgagcgcatgcagatcggcgacctggtatcggtcccgttcaacgtcgcctgcggccgc
tgccgctcctgcaaagagatgcacaccggtgtctgcctcaccgtcaacccggcgcgcgcc
ggcggtgcctacggctacgtcgacatgggcgactggaccggtggccaagccgaatacgtg
ctggtgccttacgccgacttcaacctgctgaagctgcctgagcgcgacaaggccatggaa
aagatccgtgacctgacttgcctgtccgacatcctgcccaccggctatcacggtgccgta
acggcaggcgtaggcccaggcagcacggtctacgttgccggtgctggcccggtcggcctg
gccgccgctgcctcggcgcgcctgctgggcgccgcctgcgtaatcgtcggtgacctcaac
ccggctcgcctggcccatgccaagtcgcagggcttcgaagtggtcgacctgtccaaggac
accccgctgcacgagcagatcgtcgacatcctcggcgagccggaagtggactgcgccgtc
gacgccgtcggcttcgaggcccgtggccatggccacgaaggtgccaaacacgaggccccg
gccaccgtgctgaactcgctgatgcaagtgacccgcgtggccggcaacatcggtatcccg
ggcctgtacgtgaccgaagacccaggcgcggtggatgccgctgccaagatcggcgcgctg
agcatccgcttcggcctgggctgggcgaaatcgcacagcttccacaccggccagaccccg
accatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccgcatcaacattgct
gaagtggtgggtgtgcaggtgatcaacctggatcaggcgccggaagggtatggcgagttt
gatgcgggtgtgcctaagaagtttgtgattgacccgcataagatgtggggtgcggcgtaa

DBGET integrated database retrieval system