KEGG   Pseudomonas putida F1: Pput_0382Help
Entry
Pput_0382         CDS       T00537                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppf  Pseudomonas putida F1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ppf01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppf00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppf00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(442903..445080)
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTGYRIEGGKLVVALKGGSNSGLRDDAQLIGFHGDAAAPTAVLLKHNGLHF
EIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVDADDKVIVYRNWLGLMKGDL
AESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMHGPEEVAFAAEIFSQVEDLLGM
PRNTVKVGIMDEERRTTVNLKSCIKAAAERVAFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILAIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESL
KRMAVVVDQQNAGDALYRPMAPNFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggtcctgtacgacttcgtg
aacaacgaagccatccccgggaccggcatcgtcgccgagcagttctgggcgggtgcagag
aagatcatcaatgacctcgctccaaagaacaaagccctgctcgccaagcgcgacgagctg
caagccaagatcgacgcctggcaccaggcacgcaaaggccaggcccacgacgccgcagcc
tacaaagcattcctccaggaaatcggctacctgctgccacaagccgacgatttccaggcc
accacccagaacgtggacgaagaaatcgcccacatggccggcccacaactggtcgttccg
gtgatgaacgcccgcttcgccctgaacgccgccaacgcccgctggggttcgctgtacgac
gccctttacggcaccgacgccatcagcgatgaaggcggcgccgaaaaaggccagggttac
aacaaggtacgcggcgacaaggtcatcgccttcgcccgcgccttccttgacgaagccgcg
ccactggccgccggctcgcacgttgactccacgggctaccgcatcgaaggcggcaagctg
gttgttgccttgaaaggcggcagcaacagcggcctgcgcgacgatgcgcaactgatcggc
ttccacggcgacgccgccgcacccactgccgtgctgctcaagcacaacggcctgcacttc
gaaatccaggtcgatgccagcacccccgtcggcagcaccgacgccgctggcgtcaaagac
atcctgatggagtcggcactgaccaccatcatggactgcgaagactcggttgcagccgta
gacgctgacgacaaagtcatcgtctaccgcaactggctgggcttgatgaaaggcgacctg
gccgaaagcgtgagcaagggtggcaaaaccttcacccgcaccatgaacccggaccgcgag
tacgcggcgcctaacggcggcagcgtgaccctgcacggtcgttcgttgctgttcgtgcgc
aacgttggccacctgatgaccaacccggcgatcctcgatgcccaaggcaacgaaatcccc
gaaggtatccaggacgggctgttcaccaacctgatcgccctgcacaacctcaacggcaac
accagccgcaagaatacccgcagcggcagcgtgtacatcgtcaagccgaagatgcacggc
cctgaggaagtggccttcgccgctgagatcttcagccaggtcgaagacctgctgggcatg
ccgcgcaacaccgtcaaggtcggcatcatggacgaggaacgccgtaccacggtcaacctc
aaatcctgcatcaaggcagccgccgagcgcgtggcgttcatcaacaccggcttccttgac
cgcactggcgatgaaatccacacctcgatggaagccggcgccgtggtgcgcaaaggtgcc
atgaagaacgagaagtggatcggcgcctacgaaaacaacaacgtcgacgttggcctggcc
accggcctgcaaggccgtgcgcagatcggcaaaggcatgtgggccatgcctgacctgatg
gccgccatgctcgagcagaagatcgcccacccgctggccggtgccaacaccgcttgggta
ccgtcgccaactgccgccaccctgcacgccctgcactaccacaaggtggacgtacaggcg
cgccagcgtgaactggcttcacgtaccccggcgtcggtggacgacattctggccattccg
ctggctgccgacaccaactggtcggccgaagagatccgcaacgagctggacaacaacgcc
cagggcattctcggctacgtggtgcgttggatcgaccagggcgtaggttgctcgaaggtg
ccggacatcaacaacgtcggcctgatggaagaccgtgccaccctgcgcatctctgcccag
ctgctggccaactggctgcgccacggcgtggtcagccaggagcaggtgctggaaagcctc
aagcgcatggccgtggtggtcgatcagcagaacgctggcgacgccctgtaccgcccgatg
gcgccgaacttcgacgacaacgtggcgttccaggcggctgtggaactggtggtggaaggt
ggcaagcaaccgaacggttataccgaaccggtactgcaccgccgtcgccgcgagttcaag
gcgcgtaacgggttgtaa

DBGET integrated database retrieval system