KEGG   Pseudomonas putida F1: Pput_0757Help
Entry
Pput_0757         CDS       T00537                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00900  Terpenoid backbone biosynthesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pput_0757
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Pput_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABQ76921
JGI: Pput0757
UniProt: A5VYG1
Position
complement(848795..849655)
Genome map
AA seq 286 aa AA seqDB search
MQKLTLPAPAKLNLWLHIIGRRADGYHELETVFQFLDHGDELSFALRDDGVIRLHTEIEA
VPHDSNLIVRAARMLQAQSGTTLGADIWLTKVLPMGGGIGGGSSDAATTLLALAHLWQLD
WDEDRLAALGLSLGADVPVFVRGHAAFAQGVGEQLTPVDPIEPWYVVLVPQVSVSTVEIF
SHPQLTRDSLPLKMRPVPEGNSRNDCQPVVEQNYPQVRNALNSLGKFTEARLTGTGSCVF
GAFPSKAEADKVLALLSATQTGFVAKGSNISMLHRKLQSLVKKSSA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctcaccctgcccgccccggccaagctcaacctgtggctgcacatcatcggc
cgccgcgcagacggttaccacgaactggaaacggtgtttcagtttctcgaccatggcgac
gaactgagttttgccctgcgtgacgatggcgtgatccgcttgcacaccgagatcgaggcc
gtcccccacgacagcaatctgatcgtacgggccgcgcgcatgttgcaagctcaatcgggc
accacgcttggcgccgacatttggctgaccaaggtactgcccatgggcggaggtatcggc
ggtggcagctcggacgccgcgaccaccctgctcgccctggcccacctgtggcaactggac
tgggacgaagaccgcctggccgcactggggcttagcctgggcgccgatgtgccggtgttc
gtacgcggccacgcagcattcgcgcagggcgtaggcgaacaactgactccggtcgacccg
atcgaaccctggtatgtcgtgctggtgccgcaagtgtctgtcagcacagtagaaattttt
tcacatccacagttgacacgtgattctctcccccttaagatgcgccccgttcccgaggga
aacagtcgaaatgactgccaaccggtggtagagcagaattacccccaagttcgcaatgcg
ttgaattcactgggaaaattcactgaggctcgactaaccggcactggaagttgtgtgttt
ggggccttcccaagcaaagccgaagctgataaagttctggcccttctttcagcgacccaa
acagggtttgtggcgaaaggaagcaatatttcgatgttgcatcgcaagctgcaaagtctg
gtcaagaagtcgagcgcatga

DBGET integrated database retrieval system