KEGG   Pseudomonas putida F1: Pput_0802Help
Entry
Pput_0802         CDS       T00537                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppf  Pseudomonas putida F1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pput_0802
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pput_0802
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pput_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
896611..897093
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLEALNGGELPLAPFKGQVVLVVNVASKCGLTPQYKALENLYQIYKDKGFNVL
GLPCNQFAGQEPGSEKEIQDFCSLNYGVSFPLGRKLDVNGPQRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKDGRVLARFSPRTAPDDPAVVQAIEKALV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatttcacgacctgaaactggaagcgctgaacggcggagagctgcccctcgca
cccttcaagggccaagtggtgctggtggtcaacgtcgcctccaaatgtggcctgacgccg
caatacaaggccctggaaaacctctaccagatctacaaggacaagggcttcaatgtgctt
ggcctgccgtgcaaccagtttgccgggcaggaaccgggtagcgaaaaggaaatccaggac
ttctgcagcctcaactacggggtcagcttcccgctggggcgcaagctggatgtcaacggg
ccgcagcgccattcgttgtaccgcctgctggcaggcgagggggccgagttccccggtgac
attacctggaatttcgagaagtttctggtgggcaaggatggccgggtgctggcgcgtttc
tcaccccgcacggcgccggatgacccggcagtggtgcaggccattgaaaaagcactggtc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system