KEGG   Pseudomonas putida F1: Pput_1017Help
Entry
Pput_1017         CDS       T00537                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ppf  Pseudomonas putida F1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pput_1017
   00240 Pyrimidine metabolism
    Pput_1017
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pput_1017
   03430 Mismatch repair
    Pput_1017
   03440 Homologous recombination
    Pput_1017
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pput_1017
DNA replication proteins [BR:ppf03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pput_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1143399..1143827)
Genome map
AA seq 142 aa AA seqDB search
MSKVDFYILPTDSLSARLDFACKLCEKAWRLGHRVYLHCQDAEQRSELDQRLWRFKGEAF
VPHDLAEVHADADVVLGLADNAGEHHGLLINLGASVPGFVGQFERVAEIVVEEPAIRQSA
RERFRFYREQGYALQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtcgacttctacattctgcccaccgactcgctgtcggcgcggctcgatttc
gcctgcaagctgtgcgagaaggcctggcgcctcggccaccgggtctatctgcactgccag
gatgcagaacagcgcagtgaactggaccaacgcttgtggcgcttcaagggcgaggccttc
gtgccccacgacctcgccgaggtgcatgccgatgctgacgtggttctgggcctggctgac
aacgccggcgagcaccacggcctgctgatcaacctcggcgccagcgtgccgggctttgtc
gggcagttcgagcgggtggccgaaatcgttgttgaagagccggctatccgccaatcagcc
cgtgagcgattccgtttctaccgtgaacagggctatgctctgcaagaccaccgcttacag
cgactttga

DBGET integrated database retrieval system