KEGG   Pseudomonas putida F1: Pput_1049Help
Entry
Pput_1049         CDS       T00537                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pput_1049 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_1049 (glk)
   00052 Galactose metabolism
    Pput_1049 (glk)
   00500 Starch and sucrose metabolism
    Pput_1049 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Pput_1049 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pput_1049 (glk)
   00524 Butirosin and neomycin biosynthesis
    Pput_1049 (glk)
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pput_1049 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1179719..1180678
Genome map
AA seq 319 aa AA seqDB search
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATADYTNPEQAIEAYLESQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLEVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQHWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVISGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFTGVPVWLVT
AEYSGLEGAGVALQQALDH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctggttggtgatattggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgaggtaaacgttttcgccaccgcggactacaccaaccccgagcag
gccatcgaggcctacctggaaagccaaggtatcgcccgtggtggcctggcggcggtgtgc
ctggcggtggccggcccggtcgatggcgatgaatttcgcttcaccaacaaccactggcgc
ctgagccgcacggcattttgcaagaccttggaggtcgagcgactgttgctgatcaatgat
ttcaccgctatggcgctgggcatgacgcgtctgcgcgaaggcgagttccgcgaggtgtgc
cccggccaggccgacccctcgaggccggcactggtgatcgggccaggtactggcctgggt
gtgggctcgctgctgcgtctgggcgaacagcactggaaggccctgccgggtgaaggcggg
catgttgacctgccggtaggcaatgctcgcgaagcggcaatccaccagcagatccacagt
cagatcggccatgtcagcgccgaggccgttatcagtgggggggggctggtgcggttgtac
caggcgatctgtgcgctggacggcgacacgcccaggcacaagaccccggcgcatatcacc
gacgccgcactgggcggtgagccacgggcgctggcggtggtcgagcagttctgtcgtttc
cttgggcgcgtggcgggtaacaatgtgctgacgctgggcgcgcgaggcggggtctatatt
gtgggcggtgtgattccgcgctttgccgagctgttcctgcgcagcgggtttgccgcgagt
tttgccgacaaggggtgtatgagtggctatttcaccggggtgccggtgtggctggtgacg
gcggaatattccgggttggagggggcaggggtagcgttgcagcaggcgttggatcactga

DBGET integrated database retrieval system