KEGG   Pseudomonas putida F1: Pput_1116Help
Entry
Pput_1116         CDS       T00537                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pput_1116 (glpK)
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pput_1116 (glpK)
Exosome [BR:ppf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pput_1116 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1263121..1264620)
Genome map
AA seq 499 aa AA seqDB search
MTDTQDKNYIIALDQGTTSSRAIIFDRDANVVGTSQREFAQHYPQAGWVEHDPMEIFATQ
SATMVEALAQAGISHAQVAALGITNQRETTVVWDKETGRPVYNAIVWQCRRSTEICAQLK
RDGHEGYIRETTGLVTDPYFSGTKLKWILDNVDGARERAERGELLFGTIDTWLIWKFTGG
KVHVTDYTNASRTLMFNIHSLQWDDKLLQILGIPRQMLPEVRPSSEVYGHTKSGIAIAGI
AGDQQSALFGQMCVEPGQAKNTYGTGCFLLMNTGDQAVKSSHGLLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIVNDALDTEYFASKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDCGQRLSELRVDGGAVANNFLMQFQ
ADILGTCVERPQMRETTALGAAYLAGLACGFWSGLDELRDKAIIEREFSPQLDETQKEKL
YAGWKKAVERTRDWEDHEA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacccaggataagaactacatcatcgccctggaccagggtaccaccagctca
cgggcgatcattttcgaccgtgacgccaatgttgtaggtacctcccaacgcgagttcgca
cagcattacccgcaggcgggctgggtcgagcatgacccgatggagattttcgccacacaa
agcgccaccatggtcgaggcccttgcccaggcgggtatcagccacgcccaggtcgctgcg
ctgggcatcaccaaccaacgcgaaaccacggtggtgtgggacaaggaaaccggacgcccg
gtgtacaacgccattgtctggcagtgccgccgcagcaccgagatttgtgcccagctcaag
cgcgacggccacgaaggctacattcgtgaaaccaccgggctggtcaccgacccgtatttc
tccggcaccaagctgaagtggatcctcgacaatgtcgacggcgcccgtgaacgcgccgag
cgtggcgaactgctgttcggtaccatcgacacctggctgatctggaagtttacgggtggc
aaggttcacgtcaccgactacaccaacgcctcgcgcacactgatgttcaacatccacagc
ctgcagtgggacgacaagctgctgcagatcctgggtatcccgcggcaaatgctgcctgag
gtgcgcccatcttcggaagtgtacggccacaccaagagcggcattgccattgctggtatc
gccggcgaccagcagtcggcactgttcggccagatgtgcgttgagccgggccaagccaag
aatacctacggcaccggctgcttcctgttgatgaacacgggcgaccaggcggtgaagtcg
tcccacggcctgctcactaccattgcctgcggcccgcgtggtgaggtggcctatgcactg
gaaggcgcggtattcaatggtggctctaccgtgcaatggctgcgtgacgaactgaagatc
gtcaacgacgccctggataccgagtatttcgccagcaaggtcaaggacagcaacggcgtg
tacctggtgcccgcctttaccggcctgggtgccccgtactgggacccgtatgcccgtggt
gcgttgttcggcctgacacgtggcgtgaaggtggaccacattattcgcgccgcactggag
tccatcgcctaccagacccgcgatgtcctcgacgccatgcagcaagactgtggccagcgc
ttgtccgagctgcgcgtggacggtggtgcagtggccaacaacttcctcatgcagttccag
gccgacatcctcggcacctgcgtcgagcggccgcagatgcgcgaaaccacggcgctgggc
gccgcctatctggcaggcctggcctgtggcttctggagtggcctggacgagctgcgcgac
aaggcgatcatcgagcgtgagttcagcccgcagttggacgaaacgcagaaagaaaagctg
tatgccggctggaagaaggcggtcgagcgtacccgtgactgggaagatcacgaggcatga

DBGET integrated database retrieval system