KEGG   Pseudomonas putida F1: Pput_1428Help
Entry
Pput_1428         CDS       T00537                                 

Gene name
acsA
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppf00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppf00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1601120..1603081
Genome map
AA seq 653 aa AA seqDB search
MSAAPLYPVRPEVAATTLTDEATYKAMYQQSVINPDGFWREQAQRIDWIKPFTKVKQTSF
DDHHVDIKWFADGTLNVSSNCLDRHLEERGDQLAIIWEGDDPSEHRNITYRELHEQVCKF
ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKS
KVVITADEGVRGGRRTPLKANVDLALTNPETSSVQKIIVCKRTGGDIAWHQHRDIWYEDL
MKVASSHCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRPGEV
YWCTADVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVSKIVDKHKVNILYTAPTA
IRAMMAEGQAAVEGADGSSLRLLGSVGEPINPEAWNWYYKTVGKERCPIVDTWWQTETGG
ILISPLPGATGLKPGSATRPFFGVVPALVDNLGNLIDGAAEGNLVILDSWPGQSRSLYGD
HDRFVDTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHS
KVAEAAVVGVPHDIKGQGIYVYVTLNAGIEASEQLRLELKNWVRKEIGPIASPDVIQWAP
GLPKTRSGKIMRRILRKIATGEYDALGDISTLADPGVVQHLIDTHKAMNLASA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggctccactgtatcccgttcgtcccgaggttgcggccactaccctgaccgac
gaggccacctacaaggccatgtaccagcaatcggtgatcaacccggacggcttctggcgc
gagcaggcccagcgtatcgactggatcaagccgttcaccaaggtcaagcagacctccttc
gacgaccaccatgtcgatatcaaatggttcgccgacggcactctgaacgtttcctccaac
tgcctggaccgccaccttgaagagcgcggtgaccagttggccatcatctgggaaggtgac
gacccttccgagcaccgcaacatcacttaccgcgagttgcacgagcaggtctgcaagttc
gccaacgccctgcgtggccaggatgtgcaccgcggtgacgtggtcaccatctatatgccg
atgatccccgaagcggtggtcgccatgctggcctgtgcacgcattggtgcgattcactcg
gtggtgttcggcggcttctcgcccgaggcgctggctggccgtatcatcgactgcaagtcc
aaggtggtaatcacggccgacgaaggcgtgcgtggtggccgccgcacaccgctcaaggcc
aacgtcgacctggcgctgaccaaccctgaaaccagcagcgtgcagaaaatcatcgtgtgc
aagcgcaccggtggcgacattgcctggcaccagcaccgcgacatctggtacgaagacctg
atgaaagtcgcctccagccactgcgcacccaaggaaatgggcgctgaagaggcgctgttc
atcctttatacctccggctccaccggcaagccgaagggcgtgctgcacaccacgggcggt
tacctggtttacgccgcgctgacccatgaacgcgtgttcgattaccgcccgggcgaggtg
tactggtgcaccgccgacgtcggttgggtcacaggccacagctacatcgtctacggcccg
ctggccaacggcgctaccaccttgctgttcgagggcgtgccgaactacccggacattacc
cgcgtatcgaagatcgtcgacaagcacaaggtcaatatcctctacaccgcgccaactgcc
attcgcgccatgatggctgaagggcaggcagctgttgagggcgccgacggttccagcctg
cgtctgctgggatcggtgggtgagccgatcaaccctgaggcctggaactggtactacaag
accgtcggcaaggagcgttgcccgatcgtcgacacctggtggcagaccgagaccggcggc
atcctgatcagtccgctgcctggcgccaccggcctcaagccgggttcggcaacccgtccg
ttcttcggtgtggtgcctgccctggtcgataacctgggcaacctgatcgacggtgctgcc
gaaggcaacttggtaatcctcgactcctggccgggtcagtcgcgttcgctgtacggcgac
catgaccgcttcgtcgacacctacttcaagaccttccgtggcatgtacttcaccggcgac
ggtgcgcgccgggacgaggacggctactactggatcaccggccgtgtggatgacgtgctc
aacgtgtccggccaccgcatgggtactgccgagatcgaaagcgccatggttgcgcattcg
aaggttgccgaggccgcagtggttggcgtgccgcatgacatcaaagggcagggtatttat
gtgtatgtcaccctcaatgccggcatcgaggccagcgagcaattgcgcctggagctgaag
aactgggtacgcaaggagattggcccgattgcctcgccggatgtgatccagtgggcgcca
gggctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagattgccact
ggtgaatacgacgccctgggcgatatctcgaccttggccgacccaggtgtggtgcagcac
ctgatcgatacccacaaggcgatgaacctggcttcggcctaa

DBGET integrated database retrieval system