KEGG   Pseudomonas putida F1: Pput_1428Help
Entry
Pput_1428         CDS       T00537                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pput_1428
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_1428
   00620 Pyruvate metabolism
    Pput_1428
   00640 Propanoate metabolism
    Pput_1428
  Energy metabolism
   00680 Methane metabolism
    Pput_1428
Enzymes [BR:ppf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pput_1428
Lipid biosynthesis proteins [BR:ppf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pput_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1600991..1603081
Genome map
AA seq 696 aa AA seqDB search
MPAPERFAGTGVPNYYQRRMAFVALVQLQTVPYKNNYYTEVTQMSAAPLYPVRPEVAATT
LTDEATYKAMYQQSVINPDGFWREQAQRIDWIKPFTKVKQTSFDDHHVDIKWFADGTLNV
SSNCLDRHLEERGDQLAIIWEGDDPSEHRNITYRELHEQVCKFANALRGQDVHRGDVVTI
YMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKSKVVITADEGVRGGRRTP
LKANVDLALTNPETSSVQKIIVCKRTGGDIAWHQHRDIWYEDLMKVASSHCAPKEMGAEE
ALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRPGEVYWCTADVGWVTGHSYIV
YGPLANGATTLLFEGVPNYPDITRVSKIVDKHKVNILYTAPTAIRAMMAEGQAAVEGADG
SSLRLLGSVGEPINPEAWNWYYKTVGKERCPIVDTWWQTETGGILISPLPGATGLKPGSA
TRPFFGVVPALVDNLGNLIDGAAEGNLVILDSWPGQSRSLYGDHDRFVDTYFKTFRGMYF
TGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHSKVAEAAVVGVPHDIKGQ
GIYVYVTLNAGIEASEQLRLELKNWVRKEIGPIASPDVIQWAPGLPKTRSGKIMRRILRK
IATGEYDALGDISTLADPGVVQHLIDTHKAMNLASA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgccagagcgttttgccggaacgggtgtaccaaattactaccaacgtcgaatg
gcttttgtcgctctggtacagttacaaacggttccatacaaaaacaactattacaccgag
gtaacacagatgagtgcggctccactgtatcccgttcgtcccgaggttgcggccactacc
ctgaccgacgaggccacctacaaggccatgtaccagcaatcggtgatcaacccggacggc
ttctggcgcgagcaggcccagcgtatcgactggatcaagccgttcaccaaggtcaagcag
acctccttcgacgaccaccatgtcgatatcaaatggttcgccgacggcactctgaacgtt
tcctccaactgcctggaccgccaccttgaagagcgcggtgaccagttggccatcatctgg
gaaggtgacgacccttccgagcaccgcaacatcacttaccgcgagttgcacgagcaggtc
tgcaagttcgccaacgccctgcgtggccaggatgtgcaccgcggtgacgtggtcaccatc
tatatgccgatgatccccgaagcggtggtcgccatgctggcctgtgcacgcattggtgcg
attcactcggtggtgttcggcggcttctcgcccgaggcgctggctggccgtatcatcgac
tgcaagtccaaggtggtaatcacggccgacgaaggcgtgcgtggtggccgccgcacaccg
ctcaaggccaacgtcgacctggcgctgaccaaccctgaaaccagcagcgtgcagaaaatc
atcgtgtgcaagcgcaccggtggcgacattgcctggcaccagcaccgcgacatctggtac
gaagacctgatgaaagtcgcctccagccactgcgcacccaaggaaatgggcgctgaagag
gcgctgttcatcctttatacctccggctccaccggcaagccgaagggcgtgctgcacacc
acgggcggttacctggtttacgccgcgctgacccatgaacgcgtgttcgattaccgcccg
ggcgaggtgtactggtgcaccgccgacgtcggttgggtcacaggccacagctacatcgtc
tacggcccgctggccaacggcgctaccaccttgctgttcgagggcgtgccgaactacccg
gacattacccgcgtatcgaagatcgtcgacaagcacaaggtcaatatcctctacaccgcg
ccaactgccattcgcgccatgatggctgaagggcaggcagctgttgagggcgccgacggt
tccagcctgcgtctgctgggatcggtgggtgagccgatcaaccctgaggcctggaactgg
tactacaagaccgtcggcaaggagcgttgcccgatcgtcgacacctggtggcagaccgag
accggcggcatcctgatcagtccgctgcctggcgccaccggcctcaagccgggttcggca
acccgtccgttcttcggtgtggtgcctgccctggtcgataacctgggcaacctgatcgac
ggtgctgccgaaggcaacttggtaatcctcgactcctggccgggtcagtcgcgttcgctg
tacggcgaccatgaccgcttcgtcgacacctacttcaagaccttccgtggcatgtacttc
accggcgacggtgcgcgccgggacgaggacggctactactggatcaccggccgtgtggat
gacgtgctcaacgtgtccggccaccgcatgggtactgccgagatcgaaagcgccatggtt
gcgcattcgaaggttgccgaggccgcagtggttggcgtgccgcatgacatcaaagggcag
ggtatttatgtgtatgtcaccctcaatgccggcatcgaggccagcgagcaattgcgcctg
gagctgaagaactgggtacgcaaggagattggcccgattgcctcgccggatgtgatccag
tgggcgccagggctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaag
attgccactggtgaatacgacgccctgggcgatatctcgaccttggccgacccaggtgtg
gtgcagcacctgatcgatacccacaaggcgatgaacctggcttcggcctaa

DBGET integrated database retrieval system