KEGG   Pseudomonas putida F1: Pput_1601Help
Entry
Pput_1601         CDS       T00537                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ppf  Pseudomonas putida F1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pput_1601 (recR)
DNA repair and recombination proteins [BR:ppf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pput_1601 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1792884..1793486
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDGLRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQC
RTLTEQELCPQCADPRRDDTQLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFTEVILATNPTVEGEATAHYIAQLLSEKGLVASRIAHGVPLGGEL
EMVDGGTLAHAFAGRRPISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccctctcatccgccaactgatcgacggcctgcgcatcttgccaggcgtt
ggccagaaaaccgcccagcgcatggccctgcaactgctcgagcgcgaccgcagtggcggg
ctgcgcctggctcaggccttgacccaggccatggaaggggtagggcattgccgccagtgt
cgcaccctcaccgagcaggaactgtgcccgcagtgcgccgacccgcgccgtgacgacacc
cagctgtgcgtggtcgaggggccgaccgatgtgtatgcggtggagcagacgggctaccgt
ggccgttacttcgtgctcaaggggcacctgtcgccgttggatggcctggggcctgaggcg
atcggtattccgcagctgatggcacggatcgaagagcagggcacctttaccgaggtgatc
ctggcgaccaacccgacggtggagggggaggcgacggcgcattacattgcccagttgctg
agcgagaaaggcttggtggcgtctcggattgcccatggtgtgccgctgggcggtgagctg
gagatggtggacggtggtaccttggcccatgcctttgcagggcgccggcccatttcgctc
tga

DBGET integrated database retrieval system