KEGG   Pseudomonas putida F1: Pput_1666Help
Entry
Pput_1666         CDS       T00537                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00020  Citrate cycle (TCA cycle)
ppf00310  Lysine degradation
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
ppf01200  Carbon metabolism
Module
ppf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pput_1666
  Amino acid metabolism
   00310 Lysine degradation
    Pput_1666
Enzymes [BR:ppf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pput_1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABQ77822
JGI: Pput1666
UniProt: A5W112
Position
1871392..1872615
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVLGDIV
KGEGDTVLSDELLGSIVEGGAAAAPAAAAAPAAAPAAASADAGEDDPIAAPAARKLAEEN
GIDLATVAGTGKGGRVTKEDVVAAVANKKSAPAAAPAAKPAAAAAAPVVVAAGDRTEKRV
PMTRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENG
IATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
actgacaaggttgtcctggaagtactggcgactgccgatggcgtgctgggcgacatcgtc
aagggcgagggcgacaccgtcctgtccgacgaattgctgggttcgatcgttgaaggcggt
gctgccgccgcgcctgccgcggccgccgcacctgcagctgctccggccgctgccagcgct
gacgccggcgaagatgacccgatcgctgccccagctgcgcgcaagctggctgaagaaaac
ggcatcgacctggctaccgtggcaggcaccggtaaaggcggtcgcgtcaccaaggaagac
gtggttgctgctgttgccaacaagaagtcggctcctgccgctgcaccggctgccaagcct
gccgctgctgccgctgccccggttgtcgtcgccgctggcgaccgtaccgagaagcgcgtg
ccgatgacccgcctgcgtgccaagatcgccgagcgtctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagacccacaatggcgtgcgcctgggcttcatgtcgttcttc
gtcaaggctgccaccgaagcgctgaaacgcttcccggctgtcaacgcctcgatcgacggc
aacgacatcgtctaccacggcttcgccgacgtcggtgttgccgtgtccagcgaccgtggc
ctggtggtgccggtgctgcgtaacgccgagtcgatgagcctggctgaaatcgagaacggc
atcgctaccttcggcaagaaggcccgtgacggcaaactgtccatcgaagagatgaccggt
ggtaccttcaccatcaccaacggtggcaccttcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaggctgccattctcggcatgcacaacatcatccagcgcccgatggccatc
aatggccaggtcgtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctg
atcgacggcaaggaagcggtaaccttcctggtcactatcaagaacctgctggaagatccg
tctcgcctgctgctggacatctaa

DBGET integrated database retrieval system