KEGG   Pseudomonas putida F1: Pput_1668Help
Entry
Pput_1668         CDS       T00537                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00020  Citrate cycle (TCA cycle)
ppf00640  Propanoate metabolism
ppf00660  C5-Branched dibasic acid metabolism
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
ppf01200  Carbon metabolism
Module
ppf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pput_1668
   00640 Propanoate metabolism
    Pput_1668
   00660 C5-Branched dibasic acid metabolism
    Pput_1668
Enzymes [BR:ppf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pput_1668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABQ77824
JGI: Pput1668
UniProt: A5W114
Position
1874317..1875483
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEQAAEACDKIGGNEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAAQWLGKNLVTYQTDANGQPVSKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVQQFAKI
FVGLAKLFKDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDA
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgccagtttcc
aagggtttcgcagtcgatacccctgagcaagctgcagaagcctgcgacaagatcggcggg
aacgagtgggttgtaaaagcccaggttcacgcgggtggtcgcggtaaagcgggcggcgta
aagctggttcgcagcaaggaagacgccaaggcgttcgctgcacagtggttgggcaagaat
ctggttacctaccagaccgatgccaacggtcaacccgtctccaagattctggtcgaatcc
tgcactgacatcgccaaagagctgtacctgggcgctgtagtcgatcgttcgagccgccgt
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaagtcgctcacgaaacg
cctgagaaaatcctcaaggccaccatcgacccactggtcggcgctcagccgttccagggt
cgcgagctggctttccagctgggcctggaaggcaagcaagttcaacagtttgccaagatc
ttcgttggcctggccaagctgttcaaggatcatgacctggcgctgctggaagtgaacccg
ctggtgatcaaggccgatggcgacctgcactgcctcgatgccaagatcaacatcgacgcc
aacgccatgtaccgtcagccgaagctgaaaaccttccacgacccgtcgcaggacgacgcc
cgtgaagcccacgctgccaagttcgaactgaactacgttgcccttgaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggtggtgctaccaaagagcgcgttaccgaa
gcgttcaagatcattctgtccgacagcaatgtcgcggccgttctggtcaacatcttcggc
ggcatcgttcgctgcgacatgattgccgaaggcatcattggtgcagtgaaagaagtcggc
gttaaagttccggtcgtcgttcgcctcgaaggcaacaacgccgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcattgcggcaaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaagtaa

DBGET integrated database retrieval system