KEGG   Pseudomonas putida F1: Pput_1785Help
Entry
Pput_1785         CDS       T00537                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppf  Pseudomonas putida F1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pput_1785
Enzymes [BR:ppf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pput_1785
Exosome [BR:ppf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pput_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2043496..2045706
Genome map
AA seq 736 aa AA seqDB search
MNVTTRENGGLRQRDLDALARAEHADPFAVLGPHGDGAGGQVVRAFLPNALKVRVQARDD
GRVLAEMEQGSLPGLFSAHLDEAQPYQFHIVWAGGEQVTEDPYSFGPQLGDMDLHLFAEG
NHRDLSGRFGAQPTQVDGIDGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHGAGVWE
LFIPRLGVGETYKFEVLGKDGILPLKADPLARATELPPSTASKVAGELSHAWQDHDWMAQ
RAQRHAYNAPLSIYELHPGSWRCELDEAGEVGRFYNWRELAERLVPYVQELGFTHIELLP
IMEHPFGGSWGYQPLSMFAPTSRYGSAEDFAAFIDACHQGGIGVLLDWVPAHFPTDEHGL
ARFDGTALYEYDNPLEGYHQDWNTLIYNLGRNEVRGFMMASALHWLKHFHIDGLRVDAVA
SMLYRDYSRKAGEWVPNRHGGRENLEAIDFIRHLNGVAAHEAPGALIIAEESTAWPGVSQ
PTQQGGLGFAYKWNMGWMHDTLHYIQNDPVHRTYHHNEMSFGLIYAYSEHFILPISHDEV
VHGKHSLIDKMPGDRWQKFANLRAYLTFMWAHPGKKLLFMGCEFGQWREWDHDSELDWYL
LQYPEHQGVQRLVGDLNRLYREVPALHEQDCQPQGFQWLIGDDAQNSVYAWLRWSSSGEP
VLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGAVASEAVASHGQPLS
LALNLPPLGVLIMKPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttacaacgcgtgaaaacggtggccttcggcaacgggacctcgacgccctggcc
cgcgccgaacacgccgatccttttgcggtactcggcccccacggcgacggcgcaggcggg
caggtggtccgcgcctttctgcccaatgccctgaaagtgcgcgttcaggcccgggatgac
gggcgggtgcttgccgaaatggagcagggcagcctgcctgggttgttcagcgcgcacctt
gatgaggcacagccctaccagtttcatatcgtctgggccggtggcgaacaggttaccgaa
gacccctacagcttcggcccgcaactgggtgacatggaccttcacttgttcgcggaaggc
aatcaccgcgatctgtccgggcgcttcggtgcacagccgactcaggtcgatggcatcgac
ggcgtgtgtttctcggtctgggcgccgaatgcccggcgggtgtcggtggtgggtgatttc
aacaactgggatggccgccgccaccccatgcgcctgcggcacggcgcgggggtgtgggag
ctgttcattccgcgcctgggcgtgggcgaaacctacaagttcgaagtgcttggcaaggac
ggcatactgccgctgaaggccgatccgctggcccgtgccaccgagctgccgccgagcacg
gcgtccaaggtagccggtgaactcagccacgcctggcaggaccatgactggatggcgcaa
cgcgcccagcgccatgcctacaacgcgccgttgtcgatttatgagctgcacccagggtca
tggcgctgcgagctggacgaagcgggcgaagtcgggcgtttctacaactggcgcgaactg
gccgaacggctggtgccctatgtgcaggaactgggctttacccacatcgaattgctgcca
atcatggaacacccgttcggcggctcctggggctatcaaccattgtcgatgttcgcgccc
acctcgcgctacggcagtgccgaggatttcgccgcgttcatcgacgcctgccaccaggga
ggcatcggtgtactgctggactgggtgccggcgcattttcccaccgacgaacatggcctg
gcgcgcttcgatggcactgcgctgtacgaatacgacaaccccctggagggctaccaccag
gactggaacacgctgatctacaacctcgggcgcaatgaagtgcgcggcttcatgatggct
tcggcgctgcactggttgaagcatttccacatcgacggcctgcgcgtcgatgcggtggcc
tcgatgctgtaccgcgactactcgcgcaaggccggcgaatgggtacccaaccgccacggc
gggcgtgagaacctggaagccatcgacttcatccgccacctcaacggcgtggctgcccac
gaggccccgggtgcgctgatcatcgccgaggagtccaccgcctggcccggggtcagccaa
cctacccaacagggcggcctgggttttgcctacaagtggaacatgggctggatgcacgac
accctgcactacatccagaacgacccggtgcaccgcacctaccaccacaacgagatgagt
ttcgggctgatctatgcctattccgagcacttcatcctgcccatttcccatgatgaggtg
gtgcacggcaagcattcgctgatcgacaagatgcccggcgaccgctggcagaagttcgcc
aacctgcgcgcctacctcaccttcatgtgggcacacccgggcaagaagctgctgttcatg
ggctgcgagttcggccagtggcgtgagtgggaccacgacagcgaactggactggtacctg
ctgcagtatcccgagcaccaaggcgtgcagcgcctggtgggcgacctcaaccgcctgtac
cgcgaagtgccggcgctgcacgagcaggattgccagccgcagggcttccagtggctgatc
ggtgacgacgcgcaaaacagcgtgtacgcctggctgcgctggagcagcagcggcgagccg
gtgctggtcgtggccaactttaccccggtaccccgtgagggttaccgcattggcgtgccg
ttcggcgagcgttggcaggagctgctgaacagcgatgccgagctgtatgccgggtcgaac
gtgggtaatctgggggcggtggccagtgaggcagtggccagccacgggcagccattatcg
ctggccctgaacctgccgccgctgggggtgttgatcatgaagcccgcctga

DBGET integrated database retrieval system