KEGG   Pseudomonas putida F1: Pput_1791Help
Entry
Pput_1791         CDS       T00537                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppf  Pseudomonas putida F1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pput_1791
Enzymes [BR:ppf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pput_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2053571..2055640)
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLATSVGLNRDWIDANARPQRVSDDVLRNVLEGLGHPAGDDAAVAASLRAVET
AEDSEHLPPLLTADLGQPLALARYFSAASVAHCTLEDHTSVTLSLDDQARLPGELPIGYH
QVEIDSRRFTVAVAPTRCHSLEDKVQQPPPRYWGLAVQLYSLRRPGDGGYGDCLALEQLA
RSAAERGADALAISPIHALSAIDQEHYSPYSPSSRLLLNTLYTSPAALLGEREVRMAIEA
CGLEQQLEELEQRPLVDWPRAASARLRLLEALYQGFSQGDHPLRTDFDSFREAGGQTLEH
HCRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVEALANAYPAKVEFHAFCQWLTERGL
QRAHEAARSNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLSVGAPPDILNHVGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLDYPL
DDLLRLLALESVRHQAIILGEDLGTVPDSLREKLAEKAVLGMRVLPFEQTQPGQFKPILD
WPDNALATTGTHDLAPLAGWLANRDIDWRHRLQLIDAAAELHWRHERQKERDGLRRILEA
NYGELKDNDALIDAAIRFVGHTRAPLVLVPLEDLLGCDEQPNLPGTTNGHPNWRRRFALP
VRELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcaaccagcgtcgggctgaaccgcgactggatt
gacgccaatgccaggccccagcgtgtcagcgacgacgtgctgcgcaacgtcctcgaaggc
cttggccacccggccggcgatgacgcggccgttgccgccagcctgcgtgcggtggaaacc
gccgaagacagcgaacacctgccgcctttgctgaccgccgacctaggccagccgctagcg
ctggcgcgctacttcagtgccgccagcgtggcccactgcaccctggaagatcacacctcg
gtcaccctcagcctcgatgaccaggcgcgcctgcccggcgagctgcccatcggctatcac
caggtggaaatcgacagccgccgcttcaccgtggcggtggcgccaacacgctgccacagc
ctggaagacaaggtgcaacagccgccaccacgctactggggcctggcagtgcagctgtac
agcctgcgccgccccggcgatggtggctacggcgactgcctggcgctggagcagttggcc
cgctcggccgccgagcgcggcgccgatgccttggctatcagcccgattcacgccctgtcg
gccatcgaccaggaacactacagcccctactcaccttccagtcgcctgctgctcaacacc
ctgtacaccagccccgcagccctgctgggtgaacgggaggtgcgcatggccatcgaagcc
tgcgggctggagcaacaactcgaagagctggagcagcgccctctggtcgactggccacgc
gccgccagcgcccggctgcgtttgcttgaagcgctttatcaaggcttcagccaaggcgac
cacccactacgcactgattttgacagcttccgcgaagccggcggccagacgctggagcac
cactgccgcttcgaggtgctgcaggcccaggcggtggagcacggcctcggtgccgactgg
cgcaactggcccaaagcctggcatgacccctaccacccggaagtggaggctttagccaat
gcctacccggccaaggtcgagttccacgcgttctgccagtggctgaccgaacgtggcctg
caacgtgcccacgaagcggcccgcagcaatggcatggccgtgggcctgatcgccgacctg
gcggtgggcgccgacggtgccggcagccaggcctggagccgccaggacgaactgctggcc
ggcctgagcgtgggcgcgccgcccgacatcctcaaccacgtcgggcaagactggggcatt
tgcgccttctcgcccgagggcctcaagcgcaatggctatcgcgccttcatcgagatgctg
cgggccaacctcgcccacgctggcggcctgcgcatcgaccatgtgatgggcctgcgccgg
ctatggctgatcccgcagggggccaaacccagcgaaggcgcctacctcgattacccgcta
gacgacctgttgcgcctgctggcgctggagtcggtgcgtcaccaggcgatcatcctcggc
gaagacctgggcaccgtgcccgacagcctgcgtgaaaagctggccgagaaggcggtgctg
ggcatgcgcgtgctgccgttcgagcagacccagccgggccagttcaagccgattctcgac
tggccagacaatgccctggccacaaccggcacccacgacctggcgccactggccggctgg
ctggcaaaccgcgacatcgactggagacaccgcttgcaactgattgatgctgctgccgaa
ttgcactggcgacacgagcgtcagaaagaacgcgacggcctgcgccgcatcctggaggcc
aactacggcgaactgaaggacaacgacgcgctgatcgatgcggccatccgcttcgttggc
catacccgtgcgccgctggtgctggtaccgctggaagacctgctgggctgcgacgagcaa
cccaacttgccgggcaccaccaatggccatcccaactggcggcggcgctttgcccttcca
gtacgcgaactgctcgacgatgaggacgccgcacggcgcctggagctgctggcccaggcc
cgcgaacaggcgtgggagcgtgaccgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system