KEGG   Pseudomonas putida F1: Pput_1932Help
Entry
Pput_1932         CDS       T00537                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pput_1932 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_1932 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Pput_1932 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pput_1932 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pput_1932 (adhA)
   00626 Naphthalene degradation
    Pput_1932 (adhA)
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pput_1932 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2204411..2205421)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVDVVEKTLRPLEYGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRDVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNVRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKVIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttgcaccaggccgtcgcgtggacgtggtagagaaaaccctgcgc
cctctcgaatacggcgaagcgctgctgaagatgcagtgctgcggtgtgtgccacaccgac
ctgcacgtgaaaaatggcgactttggtgacaagaccggtgtagtactgggccacgaaggt
attggcgtggttcaggaagttggcccgggcgtcacctcgctcaagccaggcgaccgtgcc
agcgtcgcctggttctaccagggttgcggacattgcgaatactgcaacagcggcaacgag
accctgtgccgcgacgtgaagaattccggttacaccgtggacggcggcatggccgaggcc
tgcatcgtcaaggccgactactcggttaaagtgcccgacggcctcgactccgctgccgcc
agcagcatcacctgcgccggcgtcacgacctacaaggcagtgaaaatctccaacgtccgc
cccggccaatggatcgccatctacgggctcggcggcctgggcaacctggccctgcaatat
gccaagaacgtgttcaacgccaaagtcatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgcggacctggtggtcaacccgctcaacgaagacgccgcgaag
gtcatccaggccaagaccggtggcgcacatgctgccgtcgttactgctgtggccaaaggc
gcgttcaactcagccgtcgatgccttgcgcgctggcgggcgactggtggccgtcgggctt
ccgtcggagtccatggacctgaatattcctcgcctggtgcttgatgggatcgaagtggtg
ggctcgctggtaggtacacgccaggacctgcaggaagccttccagtttgccgctgaaggc
aaagtggtgcccaaggtaacgctgcgaccgatcgaggatatcaaccagatctttgacgag
atgctggagggcaagatcaaaggccggatggtgatacagttcgaaggctga

DBGET integrated database retrieval system