KEGG   Pseudomonas putida F1: Pput_1949Help
Entry
Pput_1949         CDS       T00537                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppf  Pseudomonas putida F1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pput_1949
   00052 Galactose metabolism
    Pput_1949
   00500 Starch and sucrose metabolism
    Pput_1949
   00520 Amino sugar and nucleotide sugar metabolism
    Pput_1949
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pput_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2218297..2219136
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLNECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNPEGDGVLTQMVKLYKQYRCSIVAIQEVDPQETNKYGVIAGEMIRD
DIFRVTNMVEKPAPEDAPSNLAIIGRYILTPDIFDIIANTKPGKGGEIQITDALLQQAKD
GCVIAYKFKGKRFDCGGAEGYIDATNFCFENYYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgcttgttcccggcagccggctacggcacacgcttcttgcctgctacc
aaagccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtatggcgtt
gaagaagcattggatgcgggtctgaacgagatctccatcgttaccgggcgcggcaagcgc
gccctggaagaccacttcgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggtcggtattcgtcgtctgctcaacgagtgctcgttctcgtacacg
cgccagaccgaaatgaagggcctcggccacgccattctcactggccgcccactgatcggc
gacgagccgttcgcggtggtgctggcggacgacctgtgcgtcaacccggaaggtgacggc
gtgctgactcagatggtcaagctgtacaaacagtaccgctgctcgatcgtcgccatccag
gaagtcgacccgcaggaaaccaacaagtatggtgtgatcgccggtgagatgatccgcgac
gacatcttccgtgtgaccaacatggtcgaaaaaccggccccggaagacgcgccttcgaac
ctggcgatcattggccgttacatcctgaccccggatatcttcgacatcatcgccaatacc
aagccaggcaaaggcggtgaaatccagatcactgatgccctgttgcagcaggcgaaggat
ggctgcgtgattgcctacaagttcaagggcaagcgtttcgactgcggtggcgccgaaggc
tacatcgacgcgaccaacttctgcttcgagaactactacaagactggcaaggcttactga

DBGET integrated database retrieval system