KEGG   Pseudomonas putida F1: Pput_2138Help
Entry
Pput_2138         CDS       T00537                                 

Definition
(GenBank) Cellulase family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ppf  Pseudomonas putida F1
Brite
Enzymes [BR:ppf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pput_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
2425663..2426766
Genome map
AA seq 367 aa AA seqDB search
MLVGLVALGLPVFANAGSVCPWPAWERFKAELVSVDGRVIDPSDERLITTSEGQSYALFF
ALVGNDRQTFAQLLRWTSNNLAEGDLARHLPAWLWGRDGQQQWQVLDANNASDADLWIAY
SLLEAGRLWDQPAYTQLGQHLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRLNPSYL
PLQLLDRFSEVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADTKHGNAGDYD
AIRVYLWVGMLAEGAAQRRELVAHYAPMAALTQRQGLPPEHLDARSGEARGHGPAGFSAA
LLPLLAASPEHVAGLAAQRQRLREQPVEAKAYYSQVLALFGQGFDEARYRFDPHGRLLPA
WSAPCSE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagggctggtcgccttaggcctgcccgttttcgccaatgccgggtcggtttgc
ccatggcctgcctgggagcggttcaaggccgagctggtgagtgtggatgggcgggtcatc
gacccgagtgacgagcgcctgatcaccacctcggaagggcagagttacgcgctgttcttc
gccctggtaggcaacgaccggcaaaccttcgcgcagttgctgcgttggaccagcaacaac
ctcgccgagggtgacctggcccggcatctgcctgcctggctgtggggccgtgacgggcag
cagcagtggcaggtgctggacgccaacaacgccagcgatgccgatctgtggatcgcctac
agcctgctggaagcagggcggttgtgggaccagccggcctacacgcaactgggccagcac
ctgctgtggcgtatcgccgcgcagaccgtgcgcaagcttccaggccttggcgtgatgttg
ctgccaggtgactacggcttcgaagacgcccagggtacccgcctgaaccccagctacctg
ccgctgcagttgctcgaccgcttcagcgaggtggaccccttgtggggggagctggcggcc
aacacgcggcgtttgtggttggcatcgtcgccaaagggctttgcaccggactggttgctg
tggacgccggccggaaagccagcggcagacacgaaacatggcaatgccggtgattatgac
gccattcgtgtgtacctgtgggtcggcatgttggccgagggggcggcgcaacgccgcgaa
ctggtcgcccattatgcgccgatggcggcattgacccagcgccaggggctacctcctgag
cacctggatgcacgtagcggtgaagcccgcggccatggcccggcgggtttctctgcggcc
ttgctgccattgcttgctgcctcgccagagcacgtggccggcctggcggcccagcgccag
cgcttgcgcgaacaaccggtcgaggccaaggcgtattacagccaggtgctggcgctgttc
ggccagggcttcgacgaggcccgttaccgttttgacccgcacggccgcctgttgccggcc
tggagtgcgccatgcagcgaatga

DBGET integrated database retrieval system