KEGG   Pseudomonas putida F1: Pput_2138Help
Entry
Pput_2138         CDS       T00537                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppf  Pseudomonas putida F1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2425663..2426766
Genome map
AA seq 367 aa AA seqDB search
MLVGLVALGLPVFANAGSVCPWPAWERFKAELVSVDGRVIDPSDERLITTSEGQSYALFF
ALVGNDRQTFAQLLRWTSNNLAEGDLARHLPAWLWGRDGQQQWQVLDANNASDADLWIAY
SLLEAGRLWDQPAYTQLGQHLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRLNPSYL
PLQLLDRFSEVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADTKHGNAGDYD
AIRVYLWVGMLAEGAAQRRELVAHYAPMAALTQRQGLPPEHLDARSGEARGHGPAGFSAA
LLPLLAASPEHVAGLAAQRQRLREQPVEAKAYYSQVLALFGQGFDEARYRFDPHGRLLPA
WSAPCSE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagggctggtcgccttaggcctgcccgttttcgccaatgccgggtcggtttgc
ccatggcctgcctgggagcggttcaaggccgagctggtgagtgtggatgggcgggtcatc
gacccgagtgacgagcgcctgatcaccacctcggaagggcagagttacgcgctgttcttc
gccctggtaggcaacgaccggcaaaccttcgcgcagttgctgcgttggaccagcaacaac
ctcgccgagggtgacctggcccggcatctgcctgcctggctgtggggccgtgacgggcag
cagcagtggcaggtgctggacgccaacaacgccagcgatgccgatctgtggatcgcctac
agcctgctggaagcagggcggttgtgggaccagccggcctacacgcaactgggccagcac
ctgctgtggcgtatcgccgcgcagaccgtgcgcaagcttccaggccttggcgtgatgttg
ctgccaggtgactacggcttcgaagacgcccagggtacccgcctgaaccccagctacctg
ccgctgcagttgctcgaccgcttcagcgaggtggaccccttgtggggggagctggcggcc
aacacgcggcgtttgtggttggcatcgtcgccaaagggctttgcaccggactggttgctg
tggacgccggccggaaagccagcggcagacacgaaacatggcaatgccggtgattatgac
gccattcgtgtgtacctgtgggtcggcatgttggccgagggggcggcgcaacgccgcgaa
ctggtcgcccattatgcgccgatggcggcattgacccagcgccaggggctacctcctgag
cacctggatgcacgtagcggtgaagcccgcggccatggcccggcgggtttctctgcggcc
ttgctgccattgcttgctgcctcgccagagcacgtggccggcctggcggcccagcgccag
cgcttgcgcgaacaaccggtcgaggccaaggcgtattacagccaggtgctggcgctgttc
ggccagggcttcgacgaggcccgttaccgttttgacccgcacggccgcctgttgccggcc
tggagtgcgccatgcagcgaatga

DBGET integrated database retrieval system