KEGG   Pseudomonas putida F1: Pput_2459Help
Entry
Pput_2459         CDS       T00537                                 

Definition
putative phosphoketolase
Orthology
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
ppf  Pseudomonas putida F1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pput_2459
Enzymes [BR:ppf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Pput_2459
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Pput_2459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2807645..2810020)
Genome map
AA seq 791 aa AA seqDB search
MSDFPGTEELESLDAYWRAANYLTVGQIYLQGNALLTRPLTLADVKPRLLGHWGTSPGLN
LVYTHLNRLIHQYSLNVLFVTGPGHGGPALVAQAYLDGTYTELNPSVERNALGMARLFRQ
FSWPYGIGSHVGPHVPGSIHEGGELGYSLAHAYGAALDNPQLIVACVIGDGEAETGPLAA
SWHCNKFLNPARDGAVLPILHLNGYKIANPSVLSMISEEELTSLMYGYGYDPYFVEGDEP
MEVHRALARTLDVIYEKISQIQRLARYAEDPQVVDRPLWPVLILRTPKGWTGPRYVDGQR
VEGTWRSHQLPLADLDKPPHLMQLQQWLESYRPHELFDAQGTLLPELAALTPTGRRRMSA
NPHANGGLLLRALDLPHYADYCVPMPGPGQVRAEATRVLGGYVRDVMKNSLASQNFRLFG
PDETASNRLDAVFEVTDKVWLDARASDDRHLSAQGRVMEILSEHICEGWLEGYLLTGRHG
LFSCYEAFIHIVDSMINQHAKWLKTAAEVPWRKPIASLNILLTSHVWRQDHNGFSHQDPG
LLDLLANKKANLARIYLPPDANCLLSVAEHCLRSRGYINVIVAGKQMEWQWLDCEAAAVH
CQSGIGRWGWACHDDEMPEVVLACAGDVPTLEVLAAVTLLQEQAPDVRVRVVNVVDLMAL
QLSQQHPHGLSDSDFNGLFTEDRPVIFAFHGYPALIHRLIYKRANPQRFHVRGFREEGAT
TTPFDMAVINNLDRYQLLLDVFERVPRLQPQLEQARARYWATMEKHKLYLIEHGEDMPEV
AQWRWTSASRA
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttccccggtactgaagagctcgaaagcctggacgcctattggcgggcggcg
aactacctcaccgttggccagatctatctgcaaggcaatgccctgttgaccaggcccttg
accttggccgatgtcaaacctcggctgctgggccactgggggacgtccccggggctcaac
ctcgtctatacccatctgaaccggttgattcaccagtacagcctcaatgtgctgttcgtc
acggggcctggccacggcggtcctgccctggtcgctcaggcatacctcgacggtacctac
accgagctcaacccatcggtcgagcgcaacgcacttggaatggcccggctctttcggcag
ttttcctggccttatggcattggcagccatgtcggcccccatgtgcctggctccattcac
gaagggggcgaactgggctattcgctggcccatgcctatggtgccgccctggacaatccg
caactgatcgtggcgtgcgtcattggtgatggtgaggccgaaaccgggccactggctgcc
agctggcactgcaacaagttcctcaaccccgcccgcgacggcgcggtgctgcccatcttg
catctgaacggttacaagatcgccaaccccagcgtgctgtcgatgatcagcgaggaggag
ctgaccagcctcatgtatggctatggctatgatccgtattttgtcgagggtgacgagccg
atggaggtccatcgcgcgttggccaggacgctggatgtcatctacgagaagatcagccag
atccagcgcctcgcgcggtatgccgaagacccgcaggtggtcgacaggcccttgtggccg
gtgctgattcttcgtacccccaaagggtggacggggcccaggtacgtggatgggcaacgc
gtagagggcacctggcggtcccatcagttgccgttggcggacctcgacaaaccgccgcac
ctgatgcagctgcaacaatggctggaaagttaccgtccccatgagctttttgacgcacag
ggtacgttgttgcctgagctggccgcgctgaccccaactggccggcgacgcatgagcgcg
aacccccatgccaacggcggtctcttattgcgggccctggatttgccgcactacgccgat
tactgcgtgccgatgccgggccctggtcaggtgcgggccgaggcgaccagagtgctgggt
ggttatgtacgcgatgtcatgaagaacagccttgcgtcgcagaatttccgcctgttcggc
cctgacgaaacggcgtccaaccgtctggatgcggtatttgaggtgaccgacaaggtgtgg
ctggatgctcgggccagcgatgatagacacctttcggcacaggggcgggtcatggagatc
ctcagtgagcacatctgcgagggctggcttgaggggtacctgctgacgggccgccatggc
ctgttttcctgttacgaagctttcatccatatcgtcgattcgatgatcaaccaacatgcc
aaatggctcaagacagctgccgaggtgccgtggcgcaagccgatcgcctcattgaatatc
ctcctgacttcgcatgtctggcggcaggaccataatggtttctcgcaccaggacccgggc
ttgctcgacctgctggcaaacaagaaggccaaccttgcgcggatctatctgccacctgac
gccaactgcctgttgtcggtggctgagcattgcctgcgcagccgtgggtacatcaatgtg
atcgttgccggtaagcagatggagtggcaatggctcgattgcgaagcggccgccgtgcac
tgccaatcaggtatcgggcgctggggctgggcctgccatgatgacgagatgcccgaggtg
gtgcttgcctgcgcgggcgatgtgccgacactggaggtactggcggcggttacactgctg
caagagcaggctccagacgtgcgtgtgagggtggtgaatgtcgttgacctcatggcgctg
caactgtcgcaacagcaccctcacgggctgtccgacagcgatttcaacgggctgtttacc
gaagatcgaccggtcatctttgccttccacggctatccggcgctcatccaccgcctgatc
tacaaacgcgccaatccgcaacggtttcatgtccggggctttcgcgaagagggcgcaacc
accacgccattcgacatggcagtcatcaacaatctggaccgctaccagctgctgctcgat
gtgttcgagcgcgtgccacgtttgcagccccagctcgaacaggcccgcgcccgctattgg
gccacgatggagaagcacaagctctacctcatcgaacatggcgaagacatgcctgaagtt
gcgcaatggcgctggacatcagcgtcgcgtgcctga

DBGET integrated database retrieval system