KEGG   Pseudomonas putida F1: Pput_2459Help
Entry
Pput_2459         CDS       T00537                                 

Definition
putative phosphoketolase
Organism
ppf  Pseudomonas putida F1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2807645..2810020)
Genome map
AA seq 791 aa AA seqDB search
MSDFPGTEELESLDAYWRAANYLTVGQIYLQGNALLTRPLTLADVKPRLLGHWGTSPGLN
LVYTHLNRLIHQYSLNVLFVTGPGHGGPALVAQAYLDGTYTELNPSVERNALGMARLFRQ
FSWPYGIGSHVGPHVPGSIHEGGELGYSLAHAYGAALDNPQLIVACVIGDGEAETGPLAA
SWHCNKFLNPARDGAVLPILHLNGYKIANPSVLSMISEEELTSLMYGYGYDPYFVEGDEP
MEVHRALARTLDVIYEKISQIQRLARYAEDPQVVDRPLWPVLILRTPKGWTGPRYVDGQR
VEGTWRSHQLPLADLDKPPHLMQLQQWLESYRPHELFDAQGTLLPELAALTPTGRRRMSA
NPHANGGLLLRALDLPHYADYCVPMPGPGQVRAEATRVLGGYVRDVMKNSLASQNFRLFG
PDETASNRLDAVFEVTDKVWLDARASDDRHLSAQGRVMEILSEHICEGWLEGYLLTGRHG
LFSCYEAFIHIVDSMINQHAKWLKTAAEVPWRKPIASLNILLTSHVWRQDHNGFSHQDPG
LLDLLANKKANLARIYLPPDANCLLSVAEHCLRSRGYINVIVAGKQMEWQWLDCEAAAVH
CQSGIGRWGWACHDDEMPEVVLACAGDVPTLEVLAAVTLLQEQAPDVRVRVVNVVDLMAL
QLSQQHPHGLSDSDFNGLFTEDRPVIFAFHGYPALIHRLIYKRANPQRFHVRGFREEGAT
TTPFDMAVINNLDRYQLLLDVFERVPRLQPQLEQARARYWATMEKHKLYLIEHGEDMPEV
AQWRWTSASRA
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttccccggtactgaagagctcgaaagcctggacgcctattggcgggcggcg
aactacctcaccgttggccagatctatctgcaaggcaatgccctgttgaccaggcccttg
accttggccgatgtcaaacctcggctgctgggccactgggggacgtccccggggctcaac
ctcgtctatacccatctgaaccggttgattcaccagtacagcctcaatgtgctgttcgtc
acggggcctggccacggcggtcctgccctggtcgctcaggcatacctcgacggtacctac
accgagctcaacccatcggtcgagcgcaacgcacttggaatggcccggctctttcggcag
ttttcctggccttatggcattggcagccatgtcggcccccatgtgcctggctccattcac
gaagggggcgaactgggctattcgctggcccatgcctatggtgccgccctggacaatccg
caactgatcgtggcgtgcgtcattggtgatggtgaggccgaaaccgggccactggctgcc
agctggcactgcaacaagttcctcaaccccgcccgcgacggcgcggtgctgcccatcttg
catctgaacggttacaagatcgccaaccccagcgtgctgtcgatgatcagcgaggaggag
ctgaccagcctcatgtatggctatggctatgatccgtattttgtcgagggtgacgagccg
atggaggtccatcgcgcgttggccaggacgctggatgtcatctacgagaagatcagccag
atccagcgcctcgcgcggtatgccgaagacccgcaggtggtcgacaggcccttgtggccg
gtgctgattcttcgtacccccaaagggtggacggggcccaggtacgtggatgggcaacgc
gtagagggcacctggcggtcccatcagttgccgttggcggacctcgacaaaccgccgcac
ctgatgcagctgcaacaatggctggaaagttaccgtccccatgagctttttgacgcacag
ggtacgttgttgcctgagctggccgcgctgaccccaactggccggcgacgcatgagcgcg
aacccccatgccaacggcggtctcttattgcgggccctggatttgccgcactacgccgat
tactgcgtgccgatgccgggccctggtcaggtgcgggccgaggcgaccagagtgctgggt
ggttatgtacgcgatgtcatgaagaacagccttgcgtcgcagaatttccgcctgttcggc
cctgacgaaacggcgtccaaccgtctggatgcggtatttgaggtgaccgacaaggtgtgg
ctggatgctcgggccagcgatgatagacacctttcggcacaggggcgggtcatggagatc
ctcagtgagcacatctgcgagggctggcttgaggggtacctgctgacgggccgccatggc
ctgttttcctgttacgaagctttcatccatatcgtcgattcgatgatcaaccaacatgcc
aaatggctcaagacagctgccgaggtgccgtggcgcaagccgatcgcctcattgaatatc
ctcctgacttcgcatgtctggcggcaggaccataatggtttctcgcaccaggacccgggc
ttgctcgacctgctggcaaacaagaaggccaaccttgcgcggatctatctgccacctgac
gccaactgcctgttgtcggtggctgagcattgcctgcgcagccgtgggtacatcaatgtg
atcgttgccggtaagcagatggagtggcaatggctcgattgcgaagcggccgccgtgcac
tgccaatcaggtatcgggcgctggggctgggcctgccatgatgacgagatgcccgaggtg
gtgcttgcctgcgcgggcgatgtgccgacactggaggtactggcggcggttacactgctg
caagagcaggctccagacgtgcgtgtgagggtggtgaatgtcgttgacctcatggcgctg
caactgtcgcaacagcaccctcacgggctgtccgacagcgatttcaacgggctgtttacc
gaagatcgaccggtcatctttgccttccacggctatccggcgctcatccaccgcctgatc
tacaaacgcgccaatccgcaacggtttcatgtccggggctttcgcgaagagggcgcaacc
accacgccattcgacatggcagtcatcaacaatctggaccgctaccagctgctgctcgat
gtgttcgagcgcgtgccacgtttgcagccccagctcgaacaggcccgcgcccgctattgg
gccacgatggagaagcacaagctctacctcatcgaacatggcgaagacatgcctgaagtt
gcgcaatggcgctggacatcagcgtcgcgtgcctga

DBGET integrated database retrieval system