KEGG   Pseudomonas putida F1: Pput_2475Help
Entry
Pput_2475         CDS       T00537                                 

Definition
enoyl-CoA hydratase-isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppf  Pseudomonas putida F1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Pput_2475
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pput_2475
   00650 Butanoate metabolism
    Pput_2475
  Lipid metabolism
   00071 Fatty acid degradation
    Pput_2475
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pput_2475
   00310 Lysine degradation
    Pput_2475
   00360 Phenylalanine metabolism
    Pput_2475
   00380 Tryptophan metabolism
    Pput_2475
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pput_2475
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pput_2475
   00281 Geraniol degradation
    Pput_2475
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pput_2475
   00627 Aminobenzoate degradation
    Pput_2475
   00930 Caprolactam degradation
    Pput_2475
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pput_2475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2824767..2825540
Genome map
AA seq 257 aa AA seqDB search
MPRYIDVQAPEHGVQLITLQRPEALNALCTELLAELAAALQAAGDDEHVRATVITGSGKA
FAAGADIREMADRDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELAMCADIVI
AGTDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITAHRAQQAGLVSEIT
QPELTVERAMQVARSIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRQARFQGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgatatatcgacgtgcaggcgcccgaacatggcgttcagctcattaccctgcaa
cggcccgaggccttgaatgccctgtgcaccgagctactggcagaactggctgctgcgctg
caggctgccggggacgacgagcatgtccgggccacagtgattaccggcagtggcaaagct
ttcgccgcaggcgccgacatccgcgagatggctgatcgcgacctggtcggcatcctcaat
gacccgcgcgtagcgcattggcaaagcatcgccgcattcgccaaaccgctgattgccgca
gtcaacggctatgccctgggtggcggctgcgaactggcaatgtgcgccgacatcgtcatc
gccgggaccgacgcccgtttcggccagccggaaatcaaccttggcatcatccccggtgct
ggcggcacccagcgcctgttgcgtgccgtcggtaagccgttggccatgcagatggtactg
acgggggaagccatcactgcccaccgcgcccagcaggccggcctggtcagcgaaatcacc
cagcccgaactcaccgtagaacgcgccatgcaggttgcccgcagcatcgccgccaaagcg
ccgctggccgtgcgcctggccaaggaggcgttactgaaggccggtgataccgacctggcc
agcggcctacgcttcgagcgccatgccttcaccctgctggctggcaccgccgaccgcgat
gaaggcatccgcgccttccaggaaaagcgccaagcccgtttccaggggcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system