KEGG   Pseudomonas putida F1: Pput_2651Help
Entry
Pput_2651         CDS       T00537                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ppf  Pseudomonas putida F1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppf00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ppf00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3030398..3031168
Genome map
AA seq 256 aa AA seqDB search
MTLEGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPGPAMAEMARHGVKVVHHPAD
LSDVIQIEALFNLAEREFGGVDILVNNAGIQHVAPVEQFPPESWDKIIALNLSAVFHGTR
LALPGMRTRNWGRIINIASVHGLVGSMGKAAYVAAKHGVVGLTKVVGLETATSHVTCNAI
CPGWVLTPLVQKQIDDRAAQGGDRLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGS
QVRGAAWNVDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgaaggcaaaactgcactcgtcaccggttccaccagcggcattggcctgggc
atcgcccaggtattggcccgggctggcgccaacatcgtgctcaacggctttggtgacccg
ggccccgccatggcggaaatggcccggcacggggtgaaggttgtgcatcacccggccgac
ctgtcggatgtgatccagatcgaggccttgttcaacctggccgaacgtgagttcggcggc
gtcgacattctggtcaacaacgccggtatccagcatgtggcaccggttgagcagttcccg
ccagaaagctgggacaagatcatcgccctgaacctgtcggccgtattccatggcacacgc
ctggcgctgccgggcatgcgcacgcgcaactgggggcgcatcatcaatattgcttcggtg
catggcctggtcggctcgatgggcaaggcagcctacgtggcagccaagcatggtgtggtc
ggcctgaccaaggtggtcggcctggaaaccgccaccagtcatgtcacctgcaatgccatt
tgcccgggctgggtgctgacaccgctggtgcaaaagcagatcgacgatcgtgcggcccag
ggtggcgatcggctgcaagcgcagcacgatctgctggcagaaaaacaaccatcgctggcc
ttcgtcacccccgaacacctcggtgagctggtactcttcctgtgcagcgaggccggtagc
caggttcgcggcgccgcctggaacgtcgatggtggctggttggcccagtga

DBGET integrated database retrieval system