KEGG   Pseudomonas putida F1: Pput_2651Help
Entry
Pput_2651         CDS       T00537                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ppf  Pseudomonas putida F1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Pput_2651
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Pput_2651
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Pput_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3030398..3031168
Genome map
AA seq 256 aa AA seqDB search
MTLEGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPGPAMAEMARHGVKVVHHPAD
LSDVIQIEALFNLAEREFGGVDILVNNAGIQHVAPVEQFPPESWDKIIALNLSAVFHGTR
LALPGMRTRNWGRIINIASVHGLVGSMGKAAYVAAKHGVVGLTKVVGLETATSHVTCNAI
CPGWVLTPLVQKQIDDRAAQGGDRLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGS
QVRGAAWNVDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgaaggcaaaactgcactcgtcaccggttccaccagcggcattggcctgggc
atcgcccaggtattggcccgggctggcgccaacatcgtgctcaacggctttggtgacccg
ggccccgccatggcggaaatggcccggcacggggtgaaggttgtgcatcacccggccgac
ctgtcggatgtgatccagatcgaggccttgttcaacctggccgaacgtgagttcggcggc
gtcgacattctggtcaacaacgccggtatccagcatgtggcaccggttgagcagttcccg
ccagaaagctgggacaagatcatcgccctgaacctgtcggccgtattccatggcacacgc
ctggcgctgccgggcatgcgcacgcgcaactgggggcgcatcatcaatattgcttcggtg
catggcctggtcggctcgatgggcaaggcagcctacgtggcagccaagcatggtgtggtc
ggcctgaccaaggtggtcggcctggaaaccgccaccagtcatgtcacctgcaatgccatt
tgcccgggctgggtgctgacaccgctggtgcaaaagcagatcgacgatcgtgcggcccag
ggtggcgatcggctgcaagcgcagcacgatctgctggcagaaaaacaaccatcgctggcc
ttcgtcacccccgaacacctcggtgagctggtactcttcctgtgcagcgaggccggtagc
caggttcgcggcgccgcctggaacgtcgatggtggctggttggcccagtga

DBGET integrated database retrieval system