KEGG   Pseudomonas putida F1: Pput_2744Help
Entry
Pput_2744         CDS       T00537                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppf  Pseudomonas putida F1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3120718..3121716)
Genome map
AA seq 332 aa AA seqDB search
MSARTTCRYRSALHLQRLRRCLCLWVLLVLSGGSGAEPLDEPLKPLPPIPTLTPGRVELG
RQLFNDPRLSRNGTRSCASCHRLDKYGADDRAFSMGADGLPLTLNTPTVLNASLNFRQFW
NGRVESLEEQGEAVITSAHEMGGDWRVIEQRIAADVHYRQAFKDAYPDAVTKDNILSALA
DYQRTLLTPGARFDRYLQGDTEALTLEEKYGYQRFKDYGCIACHQGVNIGGNMFQKFGVF
GDYIADRGHPTEADQGRFNVTGEEADRGVFKVPSLRNVAMTAPYFHDGSAPTLERAIDVM
FQYQLGRIPSDEDRRLIMLFLKTLTAEKAGQP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgcgcacaacctgtcgttatcgttccgctcttcacctgcagcgcttgcgccgt
tgtctgtgcctgtgggtgctgctcgttctgagcggaggcagcggtgcggagccgctggac
gagccgctcaagccgctgcctccgatacccactctgacacctgggcgtgtcgagttgggc
cgccagttgttcaacgatccgcggttgtcgcgcaacggcacacggtcctgcgccagctgt
caccgtctggacaagtacggggccgatgaccgggcgttttccatgggggcagatggcctg
ccgcttacgctcaatacgccaacggtactcaatgccagccttaatttccgacagttctgg
aatggccgggtcgagtcactcgaggagcagggggaggccgtgatcaccagcgctcacgag
atgggcggagactggcgcgtgatcgagcaacgcatcgccgcagacgtgcattaccgccag
gcgttcaaggatgcctacccggacgcggtgacaaaggacaacatcctcagcgcgttggcc
gattaccaaaggacgcttcttacccctggcgcgcgcttcgatcgttacctgcagggcgat
accgaggcgcttaccctggaggaaaaatacggctaccagcgcttcaaggactatggctgc
atcgcctgccaccaaggggtgaatattgggggcaacatgttccagaaatttggcgtgttc
ggcgactacatcgcggaccgcggccaccccaccgaggcggatcagggccgcttcaacgtg
accggagaggaggccgaccggggcgtgttcaaagtgccgagcctgcgcaatgtggcgatg
accgcgccctattttcacgatggctcggcgcctacgctggagcgtgcgattgacgtgatg
tttcagtatcagcttggacgaatcccaagtgatgaggaccgcaggctcatcatgctgttc
ctcaaaacccttactgctgaaaaggcgggtcagccatga

DBGET integrated database retrieval system