KEGG   Pseudomonas putida F1: Pput_2778Help
Entry
Pput_2778         CDS       T00537                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppf  Pseudomonas putida F1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pput_2778
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pput_2778
Exosome [BR:ppf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pput_2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3158447..3159421)
Genome map
AA seq 324 aa AA seqDB search
MSNQFPSVRPRRLRQNESLRTIFQETEFRLEDLILPIFVEEGIDDFVPITSMPGVNRIPE
KLLAQEIERYARAGIKSVMTFGVSHHLDADGSDTWNENGLVARMSRICKDTVPEMVVMSD
TCFCEYTSHGHCGVLHDHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRSA
LDGAGFHDTAIMAYSTKFASSLYGPFREAGGTALKGDRKSYQMNPMNRREAVRESLLDEQ
EGADVLMVKPAGAYLDVIADIRAASRLPLAAYQVSGEYAMIKFGGLAGAIDEGRVVRESI
GAIKRAGADLILTYFAMDLAREGI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccaattcccgtccgttcgtccccgccgcctgcgccagaacgagtccctgcgc
acgatcttccaggaaaccgagttccgccttgaagacctgatcctgccgatcttcgtcgaa
gagggcatcgatgatttcgtgccgatcaccagcatgcccggtgtcaatcgtatccccgag
aaactgttggcccaggaaatcgagcgctatgcccgcgccggtatcaagtcggttatgacc
tttggcgtatcgcaccacctggatgccgatggcagcgacacctggaacgaaaacggcctg
gttgcgcgcatgtcgcgtatctgcaaggacaccgtgccggaaatggtggtgatgtccgac
acctgcttctgcgaatacaccagccacggccactgcggcgtgctgcatgaccatggcgtg
gacaacgacgccaccctggccaacctgggcaagcaggccgtcatcgccgctgctgccggt
gccgacttcattgccccctcggcggcgatggacggccaggtgcaggctatccgcagcgcg
ctggacggtgccggtttccacgacaccgcgatcatggcctactcgaccaagttcgcctcg
tcgttgtatggcccgttccgtgaggccggcggcactgcactgaagggtgaccgcaaaagt
taccagatgaacccgatgaaccgccgcgaagcggtgcgcgagtcgctgctcgacgagcag
gaaggcgcggacgtgctgatggtcaagccggccggtgcctaccttgatgtgatcgccgac
atccgcgccgcttcgcgcctgccactggcggcgtaccaggtgagtggcgagtatgcgatg
atcaagttcggtggcctggccggtgccatcgacgaaggccgggtggtgcgcgaaagcatt
ggcgcaatcaagcgtgccggtgccgacctgatcctgacctacttcgccatggacctggcg
cgcgaaggtatctga

DBGET integrated database retrieval system