KEGG   Pseudomonas putida F1: Pput_2874Help
Entry
Pput_2874         CDS       T00537                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ppf  Pseudomonas putida F1
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pput_2874
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pput_2874
   00650 Butanoate metabolism
    Pput_2874
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Pput_2874
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pput_2874
   00622 Xylene degradation
    Pput_2874
   00621 Dioxin degradation
    Pput_2874
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Pput_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3265798..3266748)
Genome map
AA seq 316 aa AA seqDB search
MTRKVKAAIIGSGNIGTDLMIKILRHGQHIEMGAMVGIDPASDGLARAQRMGVAITHEGV
EGLTRLPVFNEIDVVFDATSAGAHVKNEALLRERKPGLRMIDLTPAAIGPYCIPVVNGDD
HLDATNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTS
KAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYTLSDFADIDQIEESVQRMADAVQAYVPG
YRLKQRVQFDRIEADCPIRIPGVGDRMNGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAAL
RTAEKLAERLLASLVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaaagtcaaggctgccatcattggtagcggtaatatcggcaccgacctgatg
atcaagatactcaggcatggtcaacacattgaaatgggagcgatggtcggcatcgacccc
gcttctgacggtctggcacgcgcccaacgcatgggggtggctatcactcatgaaggtgtc
gaggggctgacgcgcctgccggtgttcaatgagatcgacgtcgtgttcgacgctactagt
gctggtgcgcatgtgaagaacgaggccctactgcgtgagcgcaagccaggactgcgcatg
atcgacctgacacccgccgcgatcggcccctattgcatcccggtggtcaatggtgacgac
cacctggatgcgacgaacgtcaatatggtcacctgtggcggccaggccaccatccccatg
gtggctgcggtatcgcgcgtagccaaggtgcattacgccgaaatcatcgccagcatctcc
agcaagagcgccggccccggcacgcgcgccaacatcgatgagttcaccgagaccacgtcc
aaggccatcgaggtggttggcggggcggcgaagggcaaggcgatcatcgtcctgaacccg
gccgagccgccgctgatgatgcgagatacggtttacacgctgagcgacttcgctgacatc
gaccagatcgaagagtcggtgcagcgcatggccgacgcagtgcaggcatacgtacccggc
tatcgcctgaagcagcgcgtgcagttcgaccgcatcgaggccgattgtccgatccgcatt
cctggcgtcggagaccgcatgaacgggctcaagacttcgatcttcctggaagtcgagggc
gctgcacactacctgccagcttatgccggcaacctggacatcatgaccagtgccgcgctg
cgcaccgccgagaagttggctgagcgtttgctcgcctccctggtcgcctga

DBGET integrated database retrieval system