KEGG   Pseudomonas putida F1: Pput_3232Help
Entry
Pput_3232         CDS       T00537                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppf  Pseudomonas putida F1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pput_3232
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pput_3232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3641756..3642664)
Genome map
AA seq 302 aa AA seqDB search
MNAKVVVVGSLNMDLVVRAQRLPRAGETLPGDSFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCPGTSSGVALITVDAASQNCIVIIPGANGLLTP
QSVLRFDALLQAAEVVICQLEVPTGTVACTLARARELGKQVILNPAPATGPLPADWFAHI
DYLTPNESEAEALTGVAVTDQDSARRAGERLLQLGAGKVIITLGAQGALLVTAQGHQHYP
APRVQPLDTTAAGDTFIGGFAAGLVRGLDEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
TP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggttgtggtggtcggcagcctcaacatggacctggtggtccgcgcccag
cgcctgccccgggccggcgaaacactccccggcgatagctttttcacggtgccgggcggc
aagggtgccaaccaggcggtggcggtagcgcggctggggggcagcgtggcgatgatcggc
aatgtgggggatgatgactacgggcggcaactgcaccgggccttgtatgtcgagggtatc
gactgtcagggtgtcagcacctgcccgggcacgtccagcggtgtggcgctgatcacggtg
gatgctgccagccagaactgtattgtcatcattcccggcgccaacggcctgctgacgccg
cagtcggtgctgcgtttcgatgcactgctgcaggccgccgaggtggtcatctgccagctg
gaagtgcccactggcactgtggcttgcacactggccagggcgcgtgagctgggcaagcag
gtcatcctgaacccagcacccgctaccggccccttgccagcggactggtttgcgcatatc
gattaccttacccctaacgaaagcgaggccgaagccttgaccggtgtggcggtgaccgac
caggacagtgcccggcgcgcaggcgagcgcttgctgcagctgggggcaggcaaagtgatt
atcaccttgggtgcgcaaggtgccttgctggttactgcccaaggccatcagcactatccg
gcgccgcgcgtgcaaccgctggacaccaccgctgccggcgataccttcattggtggcttt
gctgccggcctggtgcgtgggctggacgagggggaggcgatcgcctttggccagcgtgcc
gcggcattgtcggttacccgtgccggtgcccaaccgtcgattccctacctggcggagctg
acgccatga

DBGET integrated database retrieval system