KEGG   Pseudomonas putida F1: Pput_3597Help
Entry
Pput_3597         CDS       T00537                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppf  Pseudomonas putida F1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppf00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ppf00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4017566..4018576)
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRQLLRQPEVAGLIIFARNIDSPRQVRELCASIRAIRPE
LILAVDQEGGRVQRLRQGFVRLPAMRALADNDNAEYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGEPLRATRLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQADLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSAAQRMKVKPS
PRIARMRGQGFARTDYRQQPRWLEALGALREAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgtcaactgcttcgccagccggaagtggctggcctgatcatcttcgcccgtaat
atcgatagcccgcgccaggtgcgcgaactgtgcgcgtccatccgcgccattcgccccgag
ctgatcctggcagtggatcaggaaggtggtcgcgtacagcgtctgcgccagggctttgtg
cgcctgccggccatgcgtgcgctggccgataacgacaatgctgaatacctggctgaacaa
tgcggctggctgatggcgaccgaggtactggcagttggcctggacctcagctttgctccg
gtgctcgacctggaccaccagcgtagcgccgtggtgggcagccgcgccttcgagggtgaa
ccgctgcgtgcaacgcgactggccggcgcgttcatccgtggcatgaatgcggcaggtatg
gccgcgtgtggcaagcatttcccagggcatggctgggccgaagccgattcgcatgtggcc
atccccaccgatgagcgcagcctggaacaactgcgccaggccgacctggtgccgtttacc
cgcctgagtgggcaactggcggcagtgatgccggcgcatgtcatctacccgcaggttgac
aaccagcccgctggcttctcgcggcgttggttgcaggacatcctgcgtggcgagctgggc
tttgatggggtgattttcagtgatgacctgtcgatggctggtgcgcatgtggttggcgac
gcggccagccgtatcgaggcggcgctgagcgccggttgtgatatgggcctggtgtgcaat
gaccgggcggcggcggagctggcgctgagtgcggcgcagcgcatgaaggtcaagccatcg
ccgcggattgcccggatgcgtgggcaagggtttgcgcggaccgattatcgccagcagccg
cgctggctggaggcgttgggggcgttgagggaagctcagctggtcgattga

DBGET integrated database retrieval system