KEGG   Pseudomonas putida F1: Pput_3606Help
Entry
Pput_3606         CDS       T00537                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00071  Fatty acid degradation
ppf00280  Valine, leucine and isoleucine degradation
ppf00281  Geraniol degradation
ppf00310  Lysine degradation
ppf00362  Benzoate degradation
ppf00380  Tryptophan metabolism
ppf00410  beta-Alanine metabolism
ppf00640  Propanoate metabolism
ppf00650  Butanoate metabolism
ppf00903  Limonene and pinene degradation
ppf00930  Caprolactam degradation
ppf01040  Biosynthesis of unsaturated fatty acids
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
ppf01200  Carbon metabolism
ppf01212  Fatty acid metabolism
Module
ppf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pput_3606
   00650 Butanoate metabolism
    Pput_3606
  Lipid metabolism
   00071 Fatty acid degradation
    Pput_3606
   01040 Biosynthesis of unsaturated fatty acids
    Pput_3606
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pput_3606
   00310 Lysine degradation
    Pput_3606
   00380 Tryptophan metabolism
    Pput_3606
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pput_3606
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pput_3606
   00281 Geraniol degradation
    Pput_3606
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pput_3606
   00930 Caprolactam degradation
    Pput_3606
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pput_3606
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pput_3606
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pput_3606
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Pput_3606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ABQ79730
JGI: Pput3606
UniProt: A5W6H0
Position
complement(4026058..4028205)
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIRADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSTSARIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPELLLAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYESNRLGQKNGKGFYAYETDKRGKP
KKVFDATVLDVLKPIVFEQREVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgagctc
aagttcgacctcaagggtgagtccgtcaacaagttcaaccgccttaccctgaacgagctg
cgccaggccgtcgatgccatccgggccgatgcctcagtcaagggcgtgatcgtcagcagt
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cctgaggccgaactggtcgctggcaacctggaagccaatcgcatcttcaacgcctttgaa
gacctcgaagtgccgaccgttgccgccatcaacggcatcgcgctgggcggcggcctggaa
atgtgcctggcggccgactaccgggtcatgtccaccagcgccaggatcggcctgccggaa
gtcaagctgggtatctacccgggctttggcggtaccgtgcgcctgccgcgcctgatcggc
tcggacaacgccatcgagtggatcgccgccggcaaggaaaaccgtgccgaagacgccctg
aaagtgggggccgtcgacgccgtggtcgcccctgagctgctgctggccggtgccctcgac
ctgatcaagcgtgccatcagtggcgagctggactacaaggccaagcgccagccgaagctg
gaaaagctcaagctcaatgccatcgagcagatgatggccttcgagactgccaagggcttc
gtcgctggccaggccggcccgaactatccggccccggtcgaagcgatcaagagcatccag
aaagccgccaacttcggtcgcgacaaggccctggaagtcgaagccgcaggctttgccaag
ctggccaagacctcggtcgccgagagcctgatcggcttgttcctcaacgatcaggaactc
aagcgcaaggccaaggcgcatgacgagatcgcccacgacgtgaagcaggccgccgtgctc
ggcgccggcatcatgggcggcggtatcgcctatcagtcggcggtcaaaggtacgccgatc
ctgatgaaagacatccgcgaagaagccattcagctgggtctgaatgaggcctccaagttg
cttggcaaccgcgtcgagaagggccgcctgaccccggccaagatggccgaggccctcaac
gccattcgaccgaccctgtcctatggcgatttcgccaatgtcgacatcgtcgtcgaggct
gtggtcgagaacccgaaggtcaagcaagcggtactggcagaagtggaaggccaggtgaag
gacgatgcgatcctcgcttccaacacctctaccatctctatcaacctgctggccaaggcg
ctcaagcgcccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggtgagaagtccagtgacgtggcggtcgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgattgtggtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtactttggcggttttgccaagctggtcagcgccggtgtcgac
tttgtgcgcatcgacaaggtcatggagaagttcggctggccgatgggcccagcctacctg
atggacgtggtcggcatcgacaccggccaccacggccgtgacgtcatggccgaaggcttc
ccggatcgcatgaaggacgagcgccgctcggcagtcgacgcgttgtacgagtccaaccgc
ctgggccagaagaacggcaagggcttttacgcctacgaaaccgacaagcgcggcaaaccg
aagaaggtcttcgatgccaccgtgctcgacgtgctcaaaccgatcgtgttcgagcagcgt
gaagtcactgacgaagacatcatcaactggatgatggtcccgctgtgcctggagaccgtg
cgttgcctggaagacggcatcgtcgaaaccgctgccgaagccgacatgggcctggtctac
ggcattggtttccctcccttccgcggtggtgcgctgcgttacatcgactcgatcggtgtg
gccgaattcgtcgccctggccgatcagtatgccgacctggggccgctgtaccacccgacc
gccaagctgcgtgaaatggccaagaacggccagcgcttcttcaactga

DBGET integrated database retrieval system