KEGG   Pseudomonas putida F1: Pput_3705Help
Entry
Pput_3705         CDS       T00537                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppf  Pseudomonas putida F1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4149778..4150560
Genome map
AA seq 260 aa AA seqDB search
MTTTMHTPKDQLVKLAQQQMLTALTDNTYTVRQKLALTCRILFDGGHDSGLAGQITARAQ
EPGTYYTQQLGLGFDEIAASNLLVVDEDLTVLQGRGMANPANRFHSWLYRARPDVNCIIH
THPLHSAALSMLEVPLAISHMDLCPLFDDCAFLKEWPGVPVGNEEGEIIANAIGDKRAIL
LSHHGLLIAGRSIEEACVLALLFERAAKMQLLAMGAGDIRPIPEALGKEAHDWISTPKRH
GAAFSYYARRALRAHGDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccatgcacacccccaaggaccagcttgtcaaactcgcccagcaacagatg
ctgacggcgctgaccgacaacacctacaccgtacgacaaaagctcgccctcacctgtcgc
atcctgttcgacggcggccacgactctggcctggccgggcagatcactgcgcgtgcgcag
gaacctggcacctactacacccaacaactggggcttggcttcgacgaaatcgctgcctcc
aacctgctggtggtggacgaagacctgacggtgctgcaaggccgtggcatggccaacccg
gccaaccgcttccacagctggctgtaccgcgcccgccccgacgtcaactgcatcatccac
acccacccgctgcacagcgccgccttgtcgatgctggaagttccgctggccatctcgcac
atggacctgtgcccactgttcgacgactgtgcattcctcaaggaatggcccggtgtgccg
gtgggcaacgaagaaggcgaaatcatcgcgaacgcgattggcgacaagcgcgcaatcctg
ctttcccatcatggcctgctgatcgctgggcgttcgatcgaggaagcctgcgtgctcgcc
ctgctgttcgagcgggcagcaaagatgcaactgctggccatgggcgccggtgacatccgc
cccatccccgaagcactgggcaaagaggcccacgactggatttccacccccaaacgtcac
ggtgctgccttcagctactacgcgcgccgtgccttgcgtgcccatggcgactgcctgggc
tga

DBGET integrated database retrieval system