KEGG   Pseudomonas putida F1: Pput_3865Help
Entry
Pput_3865         CDS       T00537                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00071  Fatty acid degradation
ppf00280  Valine, leucine and isoleucine degradation
ppf00281  Geraniol degradation
ppf00310  Lysine degradation
ppf00360  Phenylalanine metabolism
ppf00362  Benzoate degradation
ppf00380  Tryptophan metabolism
ppf00410  beta-Alanine metabolism
ppf00627  Aminobenzoate degradation
ppf00640  Propanoate metabolism
ppf00650  Butanoate metabolism
ppf00903  Limonene and pinene degradation
ppf00930  Caprolactam degradation
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
ppf01212  Fatty acid metabolism
Module
ppf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pput_3865
   00650 Butanoate metabolism
    Pput_3865
  Lipid metabolism
   00071 Fatty acid degradation
    Pput_3865
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pput_3865
   00310 Lysine degradation
    Pput_3865
   00360 Phenylalanine metabolism
    Pput_3865
   00380 Tryptophan metabolism
    Pput_3865
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pput_3865
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pput_3865
   00281 Geraniol degradation
    Pput_3865
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pput_3865
   00627 Aminobenzoate degradation
    Pput_3865
   00930 Caprolactam degradation
    Pput_3865
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pput_3865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABQ79989
JGI: Pput3865
UniProt: A5W779
Position
4347980..4348669
Genome map
AA seq 229 aa AA seqDB search
MSELITYHAEDGIATLTLNNGKVNAISPDVITAFNAALDRATEERAVVIITGQPGILSGG
YDLKVMTRGPKDAISLVTAGSTLARRLLSHPFPVVVACPGNAVAKGAFLLLSADYRIGVD
GPYKVCLNEVQIGMTMHHAGIELARDRLRRSAFHRSVINAEVFDPQGAVDAGFLDKVVPA
EQLQEAAMTAARELKKLNMLAHKNTKLKVRKGLLEALDKAIELDQQHMG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctgattacctaccacgccgaagacggcatcgccacccttaccctgaacaac
ggcaaggtcaatgccatctcgccggacgtcatcactgccttcaatgcagcgctggaccgc
gctaccgaggagcgtgcagtagtgatcatcaccgggcaaccgggcattctgtcaggcggt
tacgacctcaaggtgatgacccgcggccccaaggacgccatcagcctggtcaccgccggt
tccaccctcgcccgccggctgctgtcgcacccgttcccggtggtggtcgcctgccccggc
aatgcggtggccaagggcgccttcctgctgctgtcggccgactaccgcattggcgtcgat
ggaccatacaaggtatgcctgaacgaagtgcaaatcggcatgaccatgcaccacgccggc
attgaactggcccgcgaccgcctgcgccgctcggccttccaccgctcggtgatcaatgcc
gaagtgtttgacccgcagggtgccgtggatgccggcttcctcgacaaggtggtaccggcc
gagcaattgcaggaagcggcaatgactgcagcacgagagctgaagaagctgaacatgctg
gcgcacaagaacaccaagctgaaagtgcgcaaagggctgctggaggcgctggacaaggcg
atcgagctggatcagcagcatatgggctaa

DBGET integrated database retrieval system