KEGG   Pseudomonas putida F1: Pput_3896Help
Entry
Pput_3896         CDS       T00537                                 

Definition
(GenBank) orotidine-5'-phosphate decarboxylase
  KO
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
ppf  Pseudomonas putida F1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pput_3896
Enzymes [BR:ppf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     Pput_3896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4377763..4378464)
Genome map
AA seq 233 aa AA seqDB search
MSACQTPLIVALDFPTREAALKLADQLDPALCRVKVGKELFTSSASGIVETLCDKGFEVF
LDLKFHDIPNTTAMAVKAAAEMGVWMVNVHCSGGLRMMVACREELAKRSGPQPLLIGVTV
LTSMEREDLAGIGLDVDPQEQVLRLAALAEKAGMDGLVCSALEAPALKAAHPSLQLVTPG
IRPAGSAQDDQRRILTPRQALDAGSDYLVIGRPISQAADPAQALAAVVAEIRG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctgccagacgcccctgatcgtcgccctggatttccctacccgtgaggccgcc
ctgaagctggctgaccagcttgaccctgcgctgtgccgggtgaaggttggcaaggagctg
ttcaccagcagcgcttcgggcattgtcgaaaccctgtgtgacaagggcttcgaagtgttc
ctggacctcaagttccacgacattcccaacaccaccgccatggcggtaaaggccgccgcc
gagatgggcgtgtggatggtcaacgtacattgctccggtggcctgcgcatgatggtggcc
tgccgtgaagagctggccaagcgcagcggcccgcagccgttgctgattggcgtgaccgtg
ctgaccagcatggagcgtgaagacctggccggcattggcctggatgtcgacccccaagag
caagtgctgcgtttggcggcgctggcggaaaaagcgggtatggacggtttggtgtgctcg
gcgctcgaggccccggcactgaaggcggcgcacccatcgttgcaattggtgaccccgggc
attcgcccggcgggcagcgcgcaggatgaccagcgccgcatcctcaccccgcgtcaggca
ctggatgccggttcggactacctggtgattggccggccgatcagccaggctgcagaccct
gcgcaagcgttggcagcggtggtggcggagatccgtgggtaa

DBGET integrated database retrieval system