KEGG   Pseudomonas putida F1: Pput_4033Help
Entry
Pput_4033         CDS       T00537                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppf  Pseudomonas putida F1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pput_4033
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pput_4033
Enzymes [BR:ppf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pput_4033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4551010..4551561)
Genome map
AA seq 183 aa AA seqDB search
MRAHWLTVPVLALLASTSSWAADCPTLLQGSLPELRGKGQVDLCERFAGKPLVVVNTASY
CGFAPQFEGLEATYKEYHEQGLEMLGVPSNDFKQEDADSEKTAKVCYANYGVTFTMTKTQ
AVRGKDAIPLFAELASQSSAPKWNFYKYVVDRKGKVIGNFSSLTKPDDPAFRAAIEKAIA
SQQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacattggttgacggtgccggtgctggccctgcttgccagtacatcgagctgg
gctgcagattgcccgacgttgttgcagggcagcctgccggaattgcgcggtaaggggcag
gtcgacctctgcgagcgctttgccggcaagccgctcgtggtggtgaatactgccagttat
tgcggttttgccccgcagttcgaggggcttgaggcgacgtacaaggaatatcacgagcaa
ggcctggaaatgctcggcgtgccgtccaatgacttcaagcaggaagacgccgacagtgag
aagactgccaaggtttgctatgccaactacggtgtcaccttcaccatgaccaagacgcag
gcggtgcggggcaaggatgcgataccgctgtttgcggagctggccagccagagcagtgcg
ccgaagtggaatttctacaagtatgttgtcgatcgcaagggcaaggtgatcggtaacttc
tccagcctgaccaaaccggatgatcctgcgttccgcgccgctatcgaaaaggccatcgcc
tcacagcagtaa

DBGET integrated database retrieval system