KEGG   Pseudomonas putida F1: Pput_4156Help
Entry
Pput_4156         CDS       T00537                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppf  Pseudomonas putida F1
Brite
Enzymes [BR:ppf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pput_4156 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4653234..4653908)
Genome map
AA seq 224 aa AA seqDB search
MREDDMLRRGIGMTSQRTRERLIQRLCEEGVSNTKVLDVIRRTPRHLFVDEALAHRAYED
TALPIGHNQTISQPFMVAHMSELLLEAGPLDKVLEIGTGSGYQTAILAQLVERVFSVERI
KVLQDRAKERLVELNLRNVVFRWGDGCEGWPALAPYNGIIVTAVAPEVPQALLDQLAPGG
RMVIPVGPAGEAQQLMLIVREEHGFSRRVLGAVRFVPLLNGPLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggacgatatgctgcggcgtggcatcggcatgacctctcagcgtacccgggag
cggctgatacagcgtttgtgcgaagagggggtttcgaacaccaaggtgctcgacgtgatc
cgtcgtacgccgcgccacctgttcgtcgacgaggcgctggcgcatcgagcatacgaagac
accgcgctgccgatcggccacaaccagaccatctcccagccgttcatggttgctcacatg
agcgagctgttgctcgaggccgggccgctggacaaggtgctggagattggcaccggttcg
ggctaccagacggcgatcctggctcagctggtcgagcgggtgttttcggtagagcgcatc
aaggtgctgcaggaccgggccaaagagcgcctggtggagcttaacctgcgcaacgtggta
ttccgctggggtgacggttgtgaggggtggccggcgcttgcgccgtacaacggcatcatc
gtcaccgccgtggcgccggaagtgccacaggcactgctcgaccaactggcacccggtgga
cgcatggtcatcccggtagggccggccggcgaagcgcagcaactgatgctgatcgtgcgc
gaggagcatggattctcccgtcgcgtactgggggctgtgcgcttcgtgcctctgctcaat
gggcctctggcctga

DBGET integrated database retrieval system